KEGG   Sphingomonas taxi: MC45_11220Help
Entry
MC45_11220        CDS       T03398                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K09699  2-oxoisovalerate dehydrogenase E2 component (dihydrolipoyl transacylase) [EC:2.3.1.168]
Organism
stax  Sphingomonas taxi
Pathway
stax00280  Valine, leucine and isoleucine degradation
stax00640  Propanoate metabolism
stax01100  Metabolic pathways
stax01110  Biosynthesis of secondary metabolites
stax01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:stax00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MC45_11220
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MC45_11220
Enzymes [BR:stax01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.168  dihydrolipoyllysine-residue (2-methylpropanoyl)transferase
     MC45_11220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding RnfC_N DUF2118 GCV_H HlyD_D23
Motif
Other DBs
NCBI-ProteinID: AIT06849
UniProt: A0A097EGZ7
LinkDB All DBs
Position
complement(2467144..2468517)
Genome map
AA seq 457 aa AA seqDB search
MARFTFKLPDIGEGIAEAEIVAWHVAVGDRVEEDQNIADMMTDKATVEMESPVSGVVVEL
AGEVGDQVAIGAALVVIETEDAGESAGGGEAIAAPPSAEQAEVAEQYEAENPGVEEILPG
TGRGTAGEAGGGGGAPQATPPVRQDASASSVAAPLHHPSDGPPPRAGEEPKALASPAVRA
RARDLGIDLAQVKTDADRVRHADLDAFLRYNAGQGYQAPGASRARADEQIRVIGMRRRIA
ENMAASKRNIPHFTYVDEIDVTALEAMRADLNDHRGARPKLTLLPLLIVAICRTLPQFPM
LNARYDDEAGVVTRSGRVHLGMAAQTDAGLTVPVIRDAQDRNVWQLATEIARLAEAARAN
KLKPEELGNGTITVTSLGPLGGIATTPVINRPEVAIIGPNKIVERPVFTGRGDEIRRAKL
MNLSISCDHRVVDGWDAASYVQALKTQLETPVLLFAD
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcttcaccttcaagctgccggacatcggcgagggcatcgccgaggccgagatc
gtcgcctggcacgtcgccgtcggcgatcgggtcgaggaagaccagaatatcgccgacatg
atgaccgacaaggcgaccgtcgagatggaatcgccggtgtcgggcgtcgtcgtcgagctg
gccggcgaggtcggcgatcaggtcgcgatcggcgcggcgctggtggtgatcgagaccgag
gatgcgggcgagagcgcgggagggggcgaggcgatcgccgcaccgccgagtgccgagcag
gccgaggtcgccgaacaatatgaggcggaaaacccgggcgtcgaggaaatcctccccggc
acggggagggggaccgccggcgaagccggtggtggagggggcgctccacaagcgaccccg
cccgtaaggcaagacgcgagcgcgtcgtccgtggcagcccccctccaccatccttcggat
ggtccccctccccgtgccggggaggagcctaaggccctcgcttcccccgccgtccgcgcc
cgcgcgcgcgatctcggcatcgacctcgcacaggtgaagaccgacgccgatcgcgtccgc
cacgccgatctcgacgccttcctgcgctacaacgccggccagggctatcaagcccccggc
gcatcccgcgcccgtgccgacgagcagatccgcgtcatcggcatgcgccgccgtatcgcc
gagaacatggccgcgtcgaagcgcaacatcccgcacttcacttacgtcgacgagatcgac
gtcaccgcgctggaggcaatgcgcgccgacctcaacgatcatcgcggcgcgcgccccaag
ctcacgctgctgccgctgctgatcgtcgcgatctgccgcacgctgccgcaattcccgatg
ctcaacgcgcgctacgacgacgaggcgggcgtggtcacgcgctcgggccgcgtccatctc
ggcatggcggcgcagaccgatgcaggcctcaccgtgccggtgatccgcgacgcgcaggac
aggaacgtctggcaactcgccaccgagatcgcccgcctcgccgaggcggcgcgcgccaac
aagctgaagccggaagaactcggcaacggcacgatcaccgtcacctcgctggggccgctc
ggcggcatcgcgacgacgccggtcatcaaccgccccgaagtggcgatcatcggtccgaac
aagatcgtcgaacgcccggtcttcaccggtcgcggcgacgagatccgccgcgccaagctg
atgaacctgtcgatcagctgcgatcatcgcgtcgtcgatggctgggatgcggcgagctac
gtccaggcgctcaagacgcagctcgaaacgccggtcctattgttcgcggactga

DBGET integrated database retrieval system