KEGG   Sphingomonas taxi: MC45_12055Help
Entry
MC45_12055        CDS       T03398                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
stax  Sphingomonas taxi
Brite
KEGG Orthology (KO) [BR:stax00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MC45_12055
Enzymes [BR:stax01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     MC45_12055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like DAO FAD_binding_3 AlaDh_PNT_C Thi4 NAD_binding_7 Glutaredoxin K_oxygenase NAD_binding_8 FMO-like DUF2597
Motif
Other DBs
NCBI-ProteinID: AIT06993
UniProt: A0A097EHE7
LinkDB All DBs
Position
2639043..2640629
Genome map
AA seq 528 aa AA seqDB search
MLDANLTQQLKAYLVNIREPIELVASLGDDAKSQQMRELIDEIAALSDKITTATGDDARR
PSFMIRRTGTDIGVRFAGLPMGHEFTSLVLALLQVGGHPSKAAQDLLDQVRGLDGDYRFE
TYFSLSCANCPDVVQALNLMAVLNPRVTHTAIDGALFQDEVASRKVMAVPTVFLNGEVFG
QGRMELEQIVAKLDTGASARAAASIAAKDAFDVLVVGGGPAGAAAAIYTARKGIRTGILA
ERFGGQVADTMAIENLVSVPHTEGPKLVADLERHVREYDVDIMNLQRAEKLIPAPEGGLH
ELVLENGASLKARTVILSTGARWRQMNVPGEDAYKNKGVAYCPHCDGPLFKGKRVAVIGG
GNSGVEAAIDLAGLVAHVTLIEYDTDLRADAVLQRKLASLTNVTIITSALTTEVHGDGDK
VTALSYRDRTHGTMHRVELEGIFVQIGLVPNTEWLAGSIALSPRGEIEVDDRGHTSQPGI
FAAGDATTVPFKQIVIAMGAGSTAALAAFDHLIRLPAEETHDWEEAAE
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccaatctgacgcagcagctgaaggcctatctggtcaacatccgcgagccc
atcgaactggtcgccagcctgggcgacgacgccaagtcgcagcagatgcgcgagctgatc
gacgagatcgccgcactgtccgacaagatcaccaccgcgaccggcgacgatgcgcgccgc
cccagcttcatgatccgccgcaccggcaccgatatcggcgtgcgcttcgccggcctgccg
atggggcatgaattcacctcgctggtgctggcgctgctccaggtcggcggtcatccgtcg
aaggcggcgcaggacctgctcgaccaagtccgcggcctcgacggcgactatcggttcgag
acctatttctcgctgtcctgcgccaattgccccgacgtggtgcaggcgctcaacctgatg
gcggtccttaatccgcgcgtgacgcacaccgcgatcgacggcgcgctgttccaggacgag
gtcgccagccgcaaggtgatggcggtgccgacggtcttcctcaacggcgaggtgttcggc
cagggccggatggagctggagcagatcgtcgccaagctcgacaccggcgcctcggcgcgg
gccgcggcgtcgatcgccgccaaggatgcgttcgacgtgctcgtcgtcggcggcggcccc
gccggtgccgcggcggcgatctacaccgcgcgcaagggcatccgcaccggcatcctcgcc
gagcggttcggcggtcaggtcgccgacacgatggcgatcgagaatctcgtctcggtgccg
cataccgaggggccgaagctggtcgccgatctcgaacgccacgtccgcgaatatgacgtc
gacatcatgaacctccagcgcgccgaaaagctgatcccggcgcccgagggcggcctgcac
gaactggtgctggaaaatggcgcatcgctcaaggcgcgcaccgtcatcctgtcgaccggc
gcgcgctggcggcagatgaacgtgccgggcgaggacgcctataagaacaagggtgtcgct
tattgcccgcattgcgacggcccgctgttcaagggcaagcgcgtcgcggtgatcggcggc
ggcaactcgggcgtcgaggcggcgatcgacctcgccgggctggtcgcgcacgtcacgctg
atcgaatatgacaccgacctgcgcgccgatgccgtgctccagcgcaagctcgccagcctg
accaacgtcacgatcatcacctcggcgctgaccaccgaagtgcatggcgacggcgacaag
gtaaccgcgctctcctatcgcgatcgcacccacggcacgatgcaccgcgtcgagctggag
gggatcttcgtgcagatcggactggtgccgaacaccgagtggctggcgggatcgatcgcc
ctgtctccgcgtggcgagatcgaggtcgacgaccgcggccacacgtcgcagccgggcatc
ttcgccgcgggcgatgcgaccaccgtgccgttcaagcagatcgtgatcgcgatgggtgcc
ggctccaccgccgcgctggcggcgttcgaccacctcatccgcctccccgcggaagaaacg
cacgactgggaagaagcggcggaataa

DBGET integrated database retrieval system