KEGG   Sphingomonas taxi: MC45_12850Help
Entry
MC45_12850        CDS       T03398                                 

Definition
(GenBank) methylmalonate-semialdehyde dehydrogenase
  KO
K00140  malonate-semialdehyde dehydrogenase (acetylating) / methylmalonate-semialdehyde dehydrogenase [EC:1.2.1.18 1.2.1.27]
Organism
stax  Sphingomonas taxi
Pathway
stax00280  Valine, leucine and isoleucine degradation
stax00410  beta-Alanine metabolism
stax00562  Inositol phosphate metabolism
stax00640  Propanoate metabolism
stax01100  Metabolic pathways
stax01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:stax00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MC45_12850
   00562 Inositol phosphate metabolism
    MC45_12850
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MC45_12850
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MC45_12850
Enzymes [BR:stax01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.18  malonate-semialdehyde dehydrogenase (acetylating)
     MC45_12850
    1.2.1.27  methylmalonate-semialdehyde dehydrogenase (CoA-acylating)
     MC45_12850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: AIT07111
UniProt: A0A097EHR8
LinkDB All DBs
Position
2821931..2823460
Genome map
AA seq 509 aa AA seqDB search
MRTIDHLIVGSAGGDATRYGDVFDPNSGEIQARVPLGTAADLDRAVAAAQAAQPGWAATN
PQRRARVMFRFKELVEANMDALAHLLSSEHGKVIADSKGDIQRGLEVIEFCCGIPHILKG
EYTQGAGPGIDVYSMRQPLGIGAGITPFNFPAMIPMWMFGVAIATGNAFLLKPSERDPSV
PVRLAELMREAGAPEGILQVVHGDKAMVDAILDHPAISAVSFVGSSDIAHYVYRRGVEAG
KRVQAMGGAKNHGIVMPDADLDQVVADLSGAAFGSAGERCMALPVVVPVGDKTADALREK
LIPAIAALRVGVSTDAQAHYGPVVNAAHKQRVENWIQTGVDEGAELVVDGRGFTLQGHEK
GFFVGPTLFDRVTPDMSAYKEEIFGPVLQIVRAPDFETAVRLPSEHQYGNGVAIFTRNGH
AAREFAARVNVGMVGINVPIPVPVAYHSFGGWKRSAFGDTNQHGMEGVKFWTKVKTVTQR
WPDGSALPGGSEDGGPSRIQDAFVIPTMG
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaccatcgatcatctcatcgtcggatcggccggcggtgatgccacgcgctacggc
gacgtgttcgatcccaacagcggcgagatccaggcgcgcgtgccgctcggcaccgcggcc
gatctcgaccgcgccgtcgccgcggcgcaggccgcgcagcccggctgggccgccaccaat
ccacagcgccgcgcccgcgtcatgttccgcttcaaggaactggtcgaggcgaacatggac
gcgctcgcgcatctgctctcctccgaacacggcaaggtgatcgccgattcgaagggcgac
atccagcgcgggctggaggtgatcgaattctgctgcggcatcccgcacatcctgaagggc
gaatatacgcagggcgccggccccggcatcgacgtctattcgatgcgccagccgcttggg
atcggcgcggggatcaccccgttcaacttcccggcgatgatcccgatgtggatgttcggc
gtcgccatcgccaccggcaacgccttcctgctcaagccctccgagcgcgatccgtcggtg
ccggtgcggctcgccgagctgatgcgggaggcgggcgcgcccgagggcattttgcaggtc
gtccatggcgacaaggcgatggtcgacgcgatcctcgatcatcccgcgatcagcgcggtc
agcttcgtcgggtcgagcgacatcgcgcattacgtctaccgccgcggcgtcgaggcgggc
aagcgcgtgcaggcgatgggcggcgccaagaaccacggcatcgtcatgcccgacgccgat
ctcgaccaggtcgtcgccgatctgtcgggcgcggccttcggctcggcgggcgagcgctgc
atggcgctgcccgtggtggtgccggtcggcgacaagaccgccgatgcgctgcgcgagaaa
ctgatcccggcgatcgcggcgctgcgcgtcggcgtgtcgaccgatgcgcaggcgcattac
ggcccggtggtcaacgccgcgcacaagcagcgcgtcgaaaactggatccagaccggcgtc
gacgagggcgccgagctggtcgtcgacggccgcggcttcacgctgcaggggcatgagaag
ggcttcttcgtcggcccgaccttgttcgaccgcgtcacgcccgacatgtcggcatacaag
gaggagatcttcggccccgtcctccagatcgtccgcgcgcccgatttcgagaccgcggtg
cggctgccgagcgagcatcagtacggcaacggcgtcgcgatcttcacccgcaacggccat
gccgcgcgcgagttcgcggcgcgggtcaatgtcgggatggtcgggatcaacgtgccgatc
ccggtgccggtcgcctatcacagcttcggcggctggaagcgcagcgcgttcggcgacacc
aaccagcacggcatggaaggcgtcaaattctggaccaaggtcaagacggtgacgcagcgc
tggcccgacggctcggcgctccccggcggcagcgaggacggcggcccgagccgcatccag
gatgccttcgtcatcccgacgatgggctga

DBGET integrated database retrieval system