KEGG   Sphingomonas taxi: MC45_13940Help
Entry
MC45_13940        CDS       T03398                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
stax  Sphingomonas taxi
Pathway
stax00620  Pyruvate metabolism
stax00680  Methane metabolism
stax01100  Metabolic pathways
stax01120  Microbial metabolism in diverse environments
stax01200  Carbon metabolism
Module
stax_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:stax00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MC45_13940
  09102 Energy metabolism
   00680 Methane metabolism
    MC45_13940
Enzymes [BR:stax01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     MC45_13940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: AIT07290
UniProt: A0A097EI85
LinkDB All DBs
Position
complement(3059528..3062212)
Genome map
AA seq 894 aa AA seqDB search
MATHDPASLPPIANNPDVRFLGAQLGDVIRAYGGEALFEATEAIRRASVERHRGTGSSDS
VHQQLQNLGLDETLDFVRGFMLFSMLANLAEDRQGIAAEQGADVAAALAKLAGEGIGRDQ
VQQLLAHALIVPVLTAHPTEVRRKSMIDHRNRIAQLMALKDMGRDETPDGDRVDDAITRQ
IALLWQTRVLRRERLYVTDEVETALSYMREVFLPALPALYQRWDRAFGERVPSFVRPGSW
IGGDRDGNPFVTADSLRTALGRACEAVLGFYLEGVHALGAELSISTEHVPVDAAVEALAE
ASGDTAQSRADEPYRRALSGIYARLAATHQALTGKAAPRPGHLHGEPYPDPQAFRADLVA
IAHGLSTAGALKTGGALGRLIRAVETFGFHLATLDLRQNSAVHERVVAELLKTAGVEADY
LALDEAARVALLRRELANARPLASRFMTYSEETTSELAIVQAAAEAHAKYGPACITNYIV
SMAQSVSDLLEINLLLKEVGLYRPGDAPTAAVMAVPLFETVGDLEAAPGIMTDWFALPEI
AAIAAKRGHQEVMIGYSDSNKDGGYLTSTWQLSKASTALKPVFEAAGVGMQLFHGRGGAV
GRGGGSAFAAIRAQPSGTVQGRIRITEQGEVIAAKYGTRDSAMTNLEAIAAATLLASLEP
ERLSNAENDDFCAAMDALSDTAFHAYRGLVYGTEGFRTFFRQMTPIGEIAGLKIGSRPAS
RKKSDAIEDLRAIPWVFSWAQARVMLPGWYGVGQAIAGFADKGLLREMAQGWPLFASTLA
NMEMVLAKSDIAIAGHYAELVEDEGLRSGIFGRIRDAWHQTHDGLLEVTGQTRLLEKHPA
LDASIRLRLPYIEPLNLLQIELMKRHRAGEDDPRIGEGILLSINAVATALRNSG
NT seq 2685 nt NT seq  +upstreamnt  +downstreamnt
atggccacgcacgaccccgcttcgcttccgccgatcgccaacaatcccgacgtccgcttc
ctcggcgcgcagctcggcgacgtcatccgcgcttatggcggcgaggcgctgttcgaggcg
accgaggcgatccgccgcgcctcggtcgagcggcatcgcggcaccggcagcagcgacagc
gtccaccagcagctccagaacctcggcctcgacgagacgctcgatttcgtccgcggcttc
atgctgttctcgatgctcgccaatctcgccgaggaccggcaggggatcgccgccgaacag
ggcgccgacgtcgccgccgcgctcgccaagctggcaggcgaggggatcggccgcgaccag
gtgcagcaattgctcgcccatgcgctgatcgtcccggtgctcaccgcgcatcccaccgag
gtgcggcgcaagagcatgatcgaccatcgcaaccgcatcgcgcaattgatggcactcaag
gacatgggccgcgacgagacgcccgacggcgaccgcgtcgacgatgcgatcacccgccag
atcgccttgctgtggcagacgcgcgtgctgcgccgcgagcggctctacgtcaccgacgag
gtcgagacggcgctgtcctatatgcgcgaggtgttcctgccggcgctgcccgcgctctac
cagcgctgggaccgcgcgttcggcgagcgggtgccgagcttcgtcaggccggggagctgg
atcggcggcgaccgcgacggcaatcccttcgtcaccgccgattcgctgcggaccgctttg
gggcgcgcctgcgaggcggtgctcggcttctatctggagggggtgcacgccctcggcgcc
gaactgtcgatctcgaccgagcacgtccccgtcgacgccgcggtcgaggcgctggccgag
gcgagcggcgataccgcgcaaagccgcgcggacgaaccgtatcgccgcgcgctgtccggc
atctacgcacggctcgccgcgacgcatcaggcgctgaccggcaaggcggcgccgcgcccc
ggccatctccacggcgaaccctatcccgatccgcaggcgttccgcgccgatctcgtcgcg
atcgcgcacggcctgtcgacagccggagcgctcaagaccggcggcgcgctcggccggctc
attcgagcggtcgagacgttcggcttccatctcgcgacgctcgacctgcgccagaacagc
gcggtgcacgaacgcgtcgtcgccgaattgctcaagaccgccggcgtcgaggcggactat
ctcgcgctcgacgaagcggcgcgggtcgcgttgctgcgccgcgaactcgccaatgcgcgg
ccgctcgccagccgcttcatgacctattcggaggagacgacgtccgaactggcgatcgtc
caggccgccgccgaggcgcatgcgaaatacggtccggcgtgcatcaccaattacatcgtc
tcgatggcgcagtcggtgtccgacctgctcgagatcaacctgctgctcaaggaggtcggc
ctctaccggcccggcgacgcaccgaccgcggcggtgatggcggtgccgctgttcgagacg
gtcggcgatctggaagcggcgccggggatcatgaccgactggttcgcgctgcccgagatc
gccgcgatcgcagcgaagcgcggccatcaggaagtgatgatcggctattcggacagcaac
aaggatggcggctatctcacctcgacctggcaattgtccaaggcgtcgaccgcgctgaag
ccggtgttcgaggcggcgggggtcggcatgcagctgttccacggtcgcggcggcgcggtc
gggcgcggcggcggctcggcgttcgcggcgatccgcgcgcaaccgtcgggaacggtgcag
gggcgcatccgcatcaccgaacagggcgaggtgatcgccgccaaatacggcacccgcgac
agcgcgatgaccaatctcgaggcgatcgccgcggcgacgctgctcgccagcctcgaaccc
gagcgcctgtcgaatgcagagaacgacgatttctgcgcggcgatggacgcgctgtcggac
accgccttccacgcctatcgcggcctcgtctacggcaccgaaggcttccgcaccttcttc
cgccagatgacgccgatcggcgagatcgccgggctcaagatcggcagccgccccgcgagc
cgcaagaagagcgatgcgatcgaggatctgcgcgccatcccctgggtgttcagttgggcg
caggcgcgcgtgatgctgccgggctggtatggcgtcgggcaggcgatcgccggcttcgcg
gacaaggggctgctccgggagatggcgcagggctggccgctgttcgcctcgacgcttgcc
aatatggagatggtgctggccaaatcggacatcgccatcgccggccattatgccgagctg
gtcgaggacgaggggctgcgcagcggcatcttcggccgcatccgcgatgcctggcaccag
acgcatgacggattgctcgaggtgaccgggcagacgcggttgctcgaaaagcatccggcg
ctcgatgcgtcgatccggctgcggctgccctatatcgagccgctcaacctgctccagatc
gagctgatgaagcgccatcgcgccggcgaggacgatccgcgcatcggcgagggcatcctg
ctgtcgatcaacgcggtcgcgacggcactacgcaacagcggctag

DBGET integrated database retrieval system