KEGG   Streptococcus pasteurianus: SGPB_0395Help
Entry
SGPB_0395         CDS       T01524                                 

Gene name
prkC
Definition
(GenBank) serine/threonine protein kinase, bacterial
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
stb  Streptococcus pasteurianus
Brite
KEGG Orthology (KO) [BR:stb00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:stb01001]
    SGPB_0395 (prkC)
Enzymes [BR:stb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     SGPB_0395 (prkC)
Protein kinases [BR:stb01001]
 Serine/threonine kinases: Other
  Bacterial family
   SGPB_0395 (prkC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA Kdo RIO1 APH Kinase-like FTA2 Pox_EPC_I2-L1 EOS1 Fructosamin_kin Pkinase_fungal CrgA PBP1_TM DUF2116 MRP-S32 DUF4366 Orf78
Motif
Other DBs
NCBI-ProteinID: BAK29522
UniProt: F5X532
LinkDB All DBs
Position
415061..416941
Genome map
AA seq 626 aa AA seqDB search
MIQIGKLFAGRYRILKSIGRGGMADVYLAKDLILDNEEVAIKVLRTNYQTDQIAVARFQR
EARAMAELNHPNIVSIRDIGEEDGQQFLVMEYVDGSDLKKYIQDHAPLSNNEVVRIMEEV
LSAMTLAHQQGIVHRDLKPQNILLTKDGTVKVTDFGIAVAFAETSLTQTNSMLGSVHYLS
PEQARGSKATVQSDIYAMGIMLFEMLTGHIPYDGDSAVTIALQHFQKPLPSIIDENKNVP
QALENVVIKATAKRLSDRYASTFEMSRDLMTALSYNRSREPKLVFEDTENTKTLPKVTTS
TSVPSTTEQLLKKQKAAKEDKVATENQATKAKTKKKKSRRMFGTLMKIFFAVVIVAIAIF
TYLTLTSPSTVSVPDVAGSSLSEAKTTIKSSGLKVGTVHKVSSDTVESGYVIKTSPTAGS
SKKEGSSIDIYVSKGSSGFKIKDYTGQDYQTAVKDLVNNYGVSESQIEIEEVSTSDYDEG
VIISQTPSEGETFKVSGDDKITFKVATESTVTMPNLTGYTYSEAIAALTALGVSSSHITV
YQADPNSSTGYVQVSSPSSTATITAQTPYYGETLSGNVILYLAADEEESSQAPSSSSSEP
SESKESSSSSSSTDDSSSSTESSNEQ
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgattcagattggcaaattatttgctggtcgttatcggatcctcaaatctatcggacgg
ggtggaatggcagatgtttatctggcaaaagatctcattcttgataatgaagaagtggcc
attaaggtgcttcggacgaattatcagactgatcaaattgccgtagcgcgtttccaacgg
gaagcgcgtgccatggcagaactgaaccatccaaatatcgtctcgattcgtgatattgga
gaagaagacggacagcaattcttagtaatggaatatgttgatggatcggacttgaaaaaa
tacattcaagatcatgctccgctttctaataatgaagttgttagaatcatggaagaagtc
ttatctgcgatgactttggcgcatcaacaagggattgttcaccgtgatttaaaaccacaa
aatatcttattaaccaaagatggaactgttaaagttactgactttggtatcgccgtagcc
tttgccgaaacaagtttaacgcaaaccaattcaatgctaggtagtgtgcattatttatcg
cctgaacaagcacgtggttcaaaagcgactgttcaaagtgatatttacgctatggggatt
atgttgtttgaaatgttaacaggtcacatcccatatgatggtgattcagctgttaccatt
gcgcttcaacatttccaaaaaccacttccttccatcattgatgagaataagaatgttcca
caagcactagaaaatgttgttatcaaggcgactgcaaaacgtttaagtgaccgttatgca
tcaacttttgaaatgagtcgtgatttgatgacggcactttcttacaaccgtagccgtgaa
cctaaacttgtttttgaagatactgaaaatacaaagacacttccaaaggtaacaacatca
acatctgttccttcaacgacagaacaactcttgaagaaacaaaaagcagctaaagaagat
aaagtagcaacagaaaaccaagcgactaaagctaaaacaaagaagaaaaaatcacgtcgt
atgttcggcacgttaatgaaaatcttttttgcagttgtgattgtagctattgctatcttt
acttacttgacgttgacctccccatcaaccgtgagtgttccagatgttgctggctctagt
ttatcagaagcaaaaacaacgataaaatcatcaggtcttaaagttggaaccgttcataaa
gtatcaagtgataccgttgagagtggttacgttattaagacaagtccaactgctggttca
tcgaaaaaagaagggtcatcaattgatatttacgtatcaaaaggctcatcaggattcaag
ataaaagactatacaggtcaagattatcaaacagccgttaaagatttggttaataattac
ggtgtttcagagtcgcaaattgagattgaagaagtctcaacgtcagactatgacgaaggt
gttatcatcagtcaaacgcctagtgaaggtgaaacctttaaggtaagtggtgatgataag
attacctttaaagtagccacagaaagtacagtgacaatgccgaatttgacaggctatact
tattcagaagctattgctgccttaacagctctaggcgtgtcaagttcacatattacggtt
tatcaagccgacccaaattcttctacgggttatgtgcaagtaagctcaccatcttcaaca
gcaactatcactgctcaaacaccttactatggtgaaacgttaagtggtaacgtgatactt
tacctagcagctgatgaagaagaaagctcacaggcgccatcgtcatcaagttcagaaccc
tctgaatcaaaagaatcaagttcatcaagcagcagtacggatgatagtagctcatcaaca
gaatcaagtaatgaacaataa

DBGET integrated database retrieval system