KEGG   Streptococcus pasteurianus: SGPB_0544Help
Entry
SGPB_0544         CDS       T01524                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
stb  Streptococcus pasteurianus
Brite
Enzymes [BR:stb01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SGPB_0544 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: BAK29654
UniProt: F5X5G4
LinkDB All DBs
Position
565546..566154
Genome map
AA seq 202 aa AA seqDB search
MAIILPKLPYAYDALEPYIDTETMTIHHDKHHATYVANVNAALEKHPEIGDDLEALLADV
DSIPTDIRQAVINNGGGHLNHALFWELLSPEKQEPTTQVLAAIEEAFGSFDEFKAAFTQA
ATTRFGSGWAWLVVNENGKLEVLSTANQDTPISQGKAPILALDVWEHAYYLKYRNVRPDY
IKAFFDVINWEKVAELYSKATK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggctattattttaccaaaactaccttatgcatatgacgctcttgagccttatattgat
acagaaacaatgacaattcaccatgataaacatcatgctacttatgtggcaaatgtgaat
gcggcgcttgaaaagcatccagaaattggagatgatttggaagctttgttggcagatgtt
gatagtattccaacagatatccgtcaagcggtgattaataatggtggtgggcatttgaac
cacgcccttttctgggaattgttatcacctgaaaaacaagaaccaacaacacaagtgttg
gctgcaattgaggaagcttttggctcatttgacgaattcaaagctgctttcacgcaagct
gcgacaactcgctttggatcaggttgggcttggcttgtggtgaatgaaaatggcaaactt
gaagtgctctcgacagctaatcaagacacaccaatttcacaaggaaaagcaccaattttg
gcacttgatgtttgggaacacgcttactatctcaagtatcgtaacgttcgcccagattac
atcaaagctttctttgatgtaattaattgggaaaaagttgctgagctttactcaaaagca
acaaagtga

DBGET integrated database retrieval system