KEGG   Streptococcus pasteurianus: SGPB_0905Help
Entry
SGPB_0905         CDS       T01524                                 

Gene name
amyS
Definition
(GenBank) extracellular alpha amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
stb  Streptococcus pasteurianus
Pathway
stb00500  Starch and sucrose metabolism
stb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SGPB_0905 (amyS)
Enzymes [BR:stb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     SGPB_0905 (amyS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF1939 Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: BAK29982
UniProt: F5X6E2
LinkDB All DBs
Position
complement(943409..944863)
Genome map
AA seq 484 aa AA seqDB search
MTNETLMQYFEWYLPNDGKHWQRLAADAPELAQKGISKIWLPPAFKATHAGDVGYGVYDL
FDLGEFDQKGTIRTKYGTKADYLAAIASLKENGIEPLADVILNHKAAADHTETFTVVEVS
PEDRTELLSEHFEIEGWTNFTFAGRHKTYNDFEWHWYHFTGTDYDVKTGKTGIFQIQGDN
KGWANQGLVDGENGNYDYLMYADLDFKHPEVIKNIYDWADWFVQTTGIAGFRLDAIKHID
SFFMGNFIRDMKLKYGDDFYVFGEFWNGDEQSNNDYLENTDYRFDLVDVRLHQNLFEASQ
EMEDYDLRTIFDQTLVKNHPDSAVTFVDNHDTQRGQALESTIAEWFKPAAYALILLRQTG
LPCIFYGDYYGISDEFAQENFQNEIDQLLQLRQTAVYGQEEDYFDDPNCIAWTCLGDDEH
PTALAILISNANATSKRLFVGEKWANHIFTDALENNQTEVTIDAQGYGVFPVNEKSVSAW
GPNH
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatgaaactctgatgcaatattttgaatggtatttaccaaatgacgggaaacac
tggcaacgattagcagctgatgctcccgaactagctcaaaaaggcatttctaaaatctgg
ttacctcctgcttttaaggctacacacgctggcgatgttggctatggtgtttatgacctt
ttcgacctcggagaatttgaccaaaaaggaacgattcgaaccaaatatggaactaaagcc
gattatcttgctgccattgctagcttaaaagaaaatggtattgagcccttagcggatgtg
attttgaatcacaaggcagcagctgaccacaccgaaacctttactgttgtcgaagtgtcg
ccagaggaccgcacagagcttcttagtgagcattttgaaatcgaaggttggacaaatttt
acctttgcaggtcggcataaaacctataatgattttgagtggcattggtatcattttaca
ggaacagattatgatgtcaaaactggaaaaactggaatttttcaaattcaaggcgacaat
aaaggttgggcaaatcaaggtttagttgacggtgagaatgggaattatgactatctgatg
tatgctgatttggatttcaaacaccctgaagtcattaaaaacatttacgattgggcagac
tggtttgttcaaacaactggtatcgctggttttcgattagacgctatcaaacacattgat
tctttcttcatgggcaattttatccgtgatatgaaattaaaatacggcgacgatttctac
gtctttggtgaattttggaatggtgatgaacagtctaacaacgattacttggaaaatacc
gattatcgttttgatttggtagatgtccgccttcatcaaaatctctttgaagctagccaa
gaaatggaagattatgatttgcggacaatttttgaccaaaccttggtcaagaatcaccca
gattctgctgttacttttgtcgataaccatgacacacaacgtgggcaggctttggaatca
accattgcagaatggtttaagcctgctgcttacgctttgattctacttcgtcagactgga
ttgccttgtattttctatggtgattactacggcatttctgacgaatttgcgcaagaaaat
ttccaaaacgagattgaccaattgttgcaacttcgtcaaacagctgtctatggacaggaa
gaggattactttgatgacccaaattgcattgcgtggacttgtcttggggatgatgaacac
cccacagcactagctatactcatcagtaatgctaacgctacttcaaaacgcttatttgtt
ggcgagaaatgggctaaccacatttttacagacgccttagaaaataatcagaccgaggtc
acgattgatgcgcaaggctatggcgtttttcctgttaatgaaaaatctgtcagcgcatgg
ggaccaaatcactaa

DBGET integrated database retrieval system