KEGG   Streptococcus pasteurianus: SGPB_1409Help
Entry
SGPB_1409         CDS       T01524                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
stb  Streptococcus pasteurianus
Pathway
stb00620  Pyruvate metabolism
stb00680  Methane metabolism
stb01100  Metabolic pathways
stb01120  Microbial metabolism in diverse environments
stb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:stb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SGPB_1409 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    SGPB_1409 (ppc)
Enzymes [BR:stb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SGPB_1409 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: BAK30447
UniProt: F5X2D8
LinkDB All DBs
Position
complement(1470992..1473817)
Genome map
AA seq 941 aa AA seqDB search
MTIKKLENNSTQSIITEEVKVLKDLLDEATHQMVGDEVFAKIQNIVELSASDEYVKLEKL
VAQLTNDEMVVVSRYFSILPLLINISEDVDFAYEINYQNNTNQDYLGKLSLTVDMVSESE
NSKEILENVNVVPVLTAHPTQVQRKTVLELTNHIHDLLRKYRDVRAGVVNRDKWYTDLRR
YIEIIMQTDIIREKKLKVKNEITNVMEYYNTSLIQAITKLTSEYKRLAAEKGIDLEDPKP
ITMGMWIGGDRDGNPYVTAETLRLSATVQSEVIINYYIEKLTGLYRTFSLSTTLTNISPE
VEKLAELSSDKSIYRENEPYRKAFNYIQSKLIQTLIELKASPAISQRVLESSNSISSDVY
TSTNNASVITKYLQTKFSKVSSELQEEIPSYKTAKEFKDDLLIIKQSLLDNGDDALLIGD
FSELLQAVEVFGFYLAMIDMRQDSSVNEACVAELLKSANIVEDYSALSEEEKVKVLLKEL
QEDPRTLSSTNAEKSEQLQKELAIFQTARYLKDKLGDEVIKQHIISHTESVSDMFELAIM
LKEVGLLDNQKARVQIVPLFETIEDLENSRAIMEEYLDYDIVRRWVSANKGYQEIMLGYS
DSNKDGGYLSSVWTLYKAQNELTRIGSERGIKVTFIHGRGGTVGRGGGPSYEAITSQPFG
SIKDRIRLTEQGEIIENKYGNKDVAYYNLEMLVSATIDRIVTRMITNPDEIDDFRATMDG
IVTYSNSVYRDLVFGNPHFYDYFFEATPIKEVSSLNIGSRPAARKTITEISGLRAIPWVF
SWSQSRIMFPGWYGVGSAFKNFIDAEEGNLAKLQHMYEKWPFFHSLLSNVDMVLSKSNMN
IAFQYAQLAESEEVRDVFNTILDEWQLTKNVILAIEKHEDLLEENPSLQASLDYRLPYFN
VLNYIQIELIKRLRHEELDEDYEKLIHTTINGIATGLRNSG
NT seq 2826 nt NT seq  +upstreamnt  +downstreamnt
gtgacaatcaaaaaactggagaacaatagcacccagtcgattattaccgaggaagtcaaa
gtattaaaagacttgcttgatgaggcaactcatcaaatggttggtgatgaggtgtttgcc
aaaattcaaaacattgttgaattgtcggcaagtgatgaatacgtcaaacttgaaaaatta
gtagctcaattaaccaatgatgaaatggttgtagtgtctcgctatttttcaattttgcca
cttttaatcaacatttcagaagacgttgattttgcttatgaaatcaattaccaaaataat
actaatcaggattatcttggaaaactttctctaaccgtagatatggtttcagaaagcgaa
aactctaaagaaatccttgagaatgtcaatgttgtgcctgtattaacagctcaccctaca
caagttcaacgtaagacagtcctcgaattgacaaaccacattcatgaccttttacgtaaa
taccgcgatgtcagagcgggtgttgtgaaccgtgacaaatggtacactgatttgcgccgt
tatattgaaatcatcatgcaaacggacattattcgtgagaaaaaactgaaggtaaagaat
gaaattaccaacgttatggagtattacaatacatccttaattcaagcgattaccaagttg
acttcagagtacaaacgcttagcagctgaaaaaggcatcgacttagaagatccaaaacct
atcacgatgggaatgtggattggtggtgaccgtgacggcaacccatacgtaacagctgaa
acacttcgtttatcagcaacggttcaaagtgaagtcatcattaattactacattgaaaaa
ttaacaggtctttatcgcacattctcactttcaacaaccttgactaatattagcccagaa
gttgaaaaattagcagagttatcaagcgataaatctatctaccgtgaaaatgaaccttat
cgtaaggcatttaactatattcaatcaaaattaattcaaaccttaatcgaattaaaagct
agtccagctatttctcaacgtgttttggaaagtagcaacagcattagttcagatgtttac
acaagcactaacaacgctagtgtcattacaaaatacttgcaaacaaaattctctaaagtt
tcatcagaacttcaagaagaaattccaagctataaaacagccaaagaatttaaagatgat
ttgcttatcatcaagcagtcattgcttgacaatggtgatgatgcgctcttgataggtgat
ttcagcgaattgcttcaagcagttgaagtctttggtttctatcttgcaatgattgatatg
cgtcaagattcaagtgttaacgaagcctgtgtcgcagaattgttgaaatcagcaaatatc
gttgaggattacagcgcactttcagaagaagaaaaagtgaaagttcttctcaaagaattg
caagaagacccacgtacattgtcatcaacaaatgctgaaaagtcagaacaacttcaaaaa
gaattagcaatcttccaaacagctcgttacctcaaagataaattaggtgatgaagtcatt
aaacaacacatcatttcacatactgaaagtgtttctgatatgtttgagttggctatcatg
cttaaagaagtcggacttcttgataatcaaaaagcacgtgttcaaattgtaccactcttt
gaaacaatcgaggaccttgaaaattcacgtgctatcatggaagaatatcttgattatgat
attgttcgtcgttgggtttcagcaaacaaaggttaccaagaaatcatgcttggttattca
gacagtaacaaagacggtggttacttatcatctgtttggacactttataaagctcaaaat
gaattgactcgtattggttcagaacgcggtattaaagtgacattcattcacggtcgtggt
ggtactgttggtcgtggtggtggtccatcatatgaagctatcacatcacagccattcggt
tcaatcaaagatcgtattcgtctcactgagcaaggtgaaatcattgaaaataaatacggc
aataaagacgttgcttattacaaccttgaaatgttggtttcagcaactatcgatcgtatc
gtgacacgtatgattacaaatccagatgaaattgatgatttccgtgctacaatggacggt
attgttacttactcaaatagcgtttatcgtgatttagtatttggtaatccacatttctac
gattacttcttcgaagcaacaccaatcaaggaagtgtcaagtttgaacattggttcacgt
ccagctgctcgtaaaacaatcacagaaatttcgggtctccgtgcaattccttgggtattc
tcatggtcacaaagccgtatcatgttcccaggttggtatggtgttggttcagcattcaaa
aactttattgacgctgaagaaggaaacttggcaaaacttcaacatatgtatgaaaaatgg
ccattcttccactcacttctttcaaacgttgacatggtcttgtctaaatcaaatatgaac
attgctttccaatatgctcagttggcagaaagcgaagaagtacgcgatgtctttaacact
atccttgacgaatggcaattgactaaaaatgttattttagcaatcgaaaaacacgaagat
ttgttggaagaaaacccttcgcttcaagcaagcttagattaccgcttgccatacttcaac
gttttgaactacattcaaattgagttgattaaacgtttacgtcatgaagaattggatgag
gattacgaaaaacttattcacacaactatcaacggtattgctacaggattgcgtaattct
ggctga

DBGET integrated database retrieval system