KEGG   Streptococcus pasteurianus: SGPB_1746Help
Entry
SGPB_1746         CDS       T01524                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
stb  Streptococcus pasteurianus
Brite
KEGG Orthology (KO) [BR:stb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SGPB_1746 (ahpF)
Enzymes [BR:stb01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SGPB_1746 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored FAD_binding_2 AlaDh_PNT_C Thi4 HI0933_like FAD_binding_3 Lycopene_cycl DAO NAD_binding_8 Glutaredoxin FMO-like K_oxygenase Thioredoxin_9
Motif
Other DBs
NCBI-ProteinID: BAK30761
UniProt: F5X3A2
LinkDB All DBs
Position
complement(1802770..1804308)
Genome map
AA seq 512 aa AA seqDB search
MALDAEIKTQLSQYLALIESDIVFQANLGTDENSKKVRDFIDEIVSMSDKIGFESKKLSR
MPAFRIAKKGQESGVEFAGLPLGHELTSLILALLQVSGRPPKVDEEVINRIKAIDTPLHF
ETYVSLSCHNCPDVVQAFNIMAVINPNISHTMIEGGMFQDEVKAKGIMSVPTVFHNDEIL
TSGRTNIEQLLDLIAGPVSETTFADKGIFDVLVIGGGPAGNSAAIYAARKGIKTGLLAET
FGGQVMETVGIENMIGTPYIEGPVLMSQVEEHTKSYDVDIMKAQKAIAIHKKDVIEVTLA
NGAILKSKTAILSLGAKWRNINVPGEVEFRNKGVTYCPHCDGPLFTDKKVAVIGGGNSGL
EAAIDLAGLASHVYILEFLPELKADKVLQDRAEAHDNITILKNVATKEILGDEQVTGLIY
TDRETGEDKTLNLEGVFVQIGLVPNTDWLKDSGIDLNNRGEIIVDNQGSTNVAGIFAAGD
CTDQAYKQIIISMGSGATAALGAFDYLIRMND
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggcattagatgcagaaatcaaaacacaattgtcgcaatatcttgcattaattgaatct
gatattgtttttcaggctaatcttggaacagatgaaaattctaaaaaagtcagagatttc
attgatgaaatcgtctcaatgagtgataagattggttttgaatcaaagaagcttagtcgt
atgcctgcttttcgaattgctaaaaaaggacaagaatctggtgttgaatttgccggctta
ccactgggacatgagttgacttcattgattctggcacttttacaggtttctggacgacca
ccaaaagtagatgaggaagtcatcaaccgaattaaagctattgatactcctcttcatttt
gaaacttatgtcagccttagttgtcataattgtccggatgttgtacaagctttcaatatt
atggctgtgattaatccgaatattagccataccatgattgagggaggtatgttccaagat
gaggtcaaggctaaagggattatgtccgttccaaccgtttttcacaatgatgaaatactg
acttcaggacgtaccaacattgaacaattacttgatttgattgcaggaccagtgtcagaa
acgacatttgcagataagggaatttttgatgtcttggttattggtggcgggccggctgga
aatagcgcagctatttatgctgcacgaaaaggaatcaaaacaggcttattagctgaaacg
tttggtggacaagtgatggaaaccgtcggaattgaaaatatgattggaacaccttatata
gagggaccagtgcttatgtctcaagtagaagagcataccaaatcatatgatgtcgatatc
atgaaagctcaaaaagcgatagctattcataaaaaggatgttatcgaggttacgctagct
aatggtgcgattctaaaatctaaaacagccattctatctcttggtgccaaatggcgtaat
attaatgttccgggagaagttgaatttagaaataagggagtcacttactgtcctcactgt
gatggaccactctttacagataaaaaagtagctgtcattggtggtggtaattcagggctt
gaagctgccattgatttagcaggacttgctagccatgtctatattcttgaatttttacca
gaattaaaagctgataaagtcttacaagatcgtgcagaagcacatgataatattactatt
ttgaaaaatgttgccacaaaagaaattttgggtgatgagcaggttacgggactaatttat
acggatagagaaactggcgaggacaaaacacttaacttagagggagtctttgttcaaatt
ggtctcgttccaaataccgactggctaaaagattctggcattgaccttaataatcgtggt
gaaattattgtggataatcaagggagtacaaatgttgcaggtatttttgcagctggcgac
tgtacagatcaagcatacaagcaaattattatttctatgggaagcggagctactgcagcc
ttaggggcatttgactaccttatcagaatgaatgattaa

DBGET integrated database retrieval system