KEGG   Streptococcus thermophilus CNRZ1066: str0718Help
Entry
str0718           CDS       T00212                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
stc  Streptococcus thermophilus CNRZ1066
Pathway
stc00620  Pyruvate metabolism
stc00680  Methane metabolism
stc01100  Metabolic pathways
stc01120  Microbial metabolism in diverse environments
stc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:stc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    str0718 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    str0718 (ppc)
Enzymes [BR:stc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     str0718 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AAV62313
UniProt: Q5M0E6
LinkDB All DBs
Position
676298..679120
Genome map
AA seq 940 aa AA seqDB search
MAFNKLESSNNQEIISEEVGILKELLDDATRGMAGEQGLTTIQHLVELYDEGDYEALTQA
ISEMTNDDMVFASRYFSLLPLLINISEDVDLAYEVNRKNNIDESYLGKLSETFDVVAESD
NARDILENVNVVPVLTAHPTQVQRKTMLELTNHIHELLRKHRDVKDGLINKDKWYADLRR
YVEIMMKTDIIREKKLKVKNEITNVMEYYNSSLIKAITKLSHEFKRLAVEKGIELDNPTP
ITMGMWIGGDRDGNPFVTAETLKLSATLQSEVILNYYIEKVDNLYRSFSLSSRLTEVSET
VAEMAKLSPDTSVYRENEPYRRAFSYIQSKLIQTLLFFKAGNFSNERAAKRLSENVRLGS
VSTGEVVADFVHDRLSQSLQAVSQQTTEFYETAEAFHDDLLAIKNSLLENDDSVLISGDF
EELLQAVEVFGFYLATIDMRQDSSVHEACVAELLKSANIVDNYSELTEVEKVAVLLKELQ
EDPRTLSSTNVSKSETLEKELAIFRTARLLKDYLGEEVIKQHIISHTESVSDMFELAILL
KEVGLVDTERARVQIVPLFETIEDLENSNEIMKQYLGYDIVKRWIKNSNNYQEIMLGYSD
SNKDGGYLSSGWTLYKAQNELTNIGEERGIKITFFHGRGGTVGRGGGPSYDAITSQPFGT
IKDRIRLTEQGEVIGNKYGNKDAAYYNLEMLVSATLDRMVTRQITDPDELVDFREIMDSI
VQDSNRIYRDLVFGNEHFYDYFFEASPIKEVSSLNIGSRPAARKTITDISGLRAIPWVFS
WSQNRIMLPGWYGVGSAFNHYIEAEEGNLEKLQHMFETWPFFRSLLSNVDMVLSKSDMNI
AFHYAQLAESEEVRSVFNIILDEWQLTKNVILAIEKHDDFLEESPSLKASLGFRLPYFNV
LNYIQIELIKRLRNNNLTDDEISLIHITINGIATGLRNSG
NT seq 2823 nt NT seq  +upstreamnt  +downstreamnt
ttggcttttaacaaattggaaagcagtaacaaccaggaaatcatctctgaagaagttggt
atcttgaaagaattgttggatgatgcaacacgaggcatggctggtgagcaaggcctcacg
actatccaacatttggttgaactttatgatgaaggtgactatgaggcccttacacaagcc
atttcagaaatgacaaatgatgatatggtctttgcatcacgttatttctctttgttacct
ctcttgattaatatctctgaggacgtggatttggcttatgaagtcaaccgcaaaaataat
attgatgaatcttatttaggtaagttgtctgaaacctttgatgttgtcgctgaaagcgac
aatgcgcgtgacattcttgaaaatgttaatgtcgtgccggtattgacagctcacccaact
caggttcaacgtaaaaccatgcttgaattgactaaccacattcacgaacttctccgtaag
catcgtgacgttaaggatggtcttattaataaggataaatggtatgcggatttgcgtcgt
tatgtagagattatgatgaaaacggatatcattcgtgagaagaaacttaaagttaaaaac
gaaatcactaacgttatggagtattacaactcctcattgattaaggcgattaccaagcta
tcgcatgaattcaaacgtttagcggttgaaaaaggtatcgaacttgataatccaacacct
attacaatgggaatgtggattggtggtgaccgtgacgggaacccatttgtaacggcagaa
actcttaaactttctgcgacattacaaagtgaagttatcctcaattactatattgaaaaa
gttgataatctttaccgctcattctcactctcatcacgtttgactgaagtttcagaaaca
gtagcagaaatggcgaaactttctccagatacatctgtctaccgtgaaaacgaaccatac
cgtcgtgcttttagttacattcaatctaaattgattcagacgcttcttttcttcaaagca
ggtaactttagcaatgaaagagctgctaagcgtctttctgaaaatgttcgtcttggctca
gtctcaacaggtgaagtagtagctgattttgtgcatgaccgtctcagccaaagtcttcaa
gctgtctcacaacaaactaccgaattttatgaaacagctgaagcattccatgatgatctt
ttggcaattaaaaattcacttctcgaaaatgatgattctgtcttgatttccggtgatttc
gaagagcttcttcaagctgttgaggtctttggattctaccttgcaacaattgatatgcgt
caggattcaagcgttcatgaagcttgtgtggcagagttgcttaaatctgcaaacattgtt
gacaactacagtgaattgacagaggttgaaaaggttgctgttcttcttaaagaattgcaa
gaagatccacgtaccttatcatcaacaaatgtatctaagtctgaaacgcttgaaaaagaa
ttagctatcttccgtactgctcgtcttttgaaggactatcttggtgaagaagtcatcaaa
caacatatcatctctcacactgagagcgtctcagatatgtttgagttagccatccttctt
aaagaagttggtttagttgatactgagcgtgcgcgtgtccaaatcgttccactgtttgaa
accatcgaagacttggaaaactctaatgaaatcatgaaacaataccttggttatgatatt
gttaaacgatggattaagaatagcaataactaccaagaaatcatgttgggttactcagat
tcaaacaaagatggtggttacttgtcttcaggttggacgctttacaaggctcagaacgaa
ttgaccaatattggtgaagagcgtggcattaaaattaccttcttccatggccgtggtggt
acagttggtcgtggtggtggcccatcttacgatgctattacttctcaaccatttggtact
attaaagaccgtatccgtttgacggagcaaggtgaggttatcggtaataaatatggcaat
aaggatgcagcttactacaatcttgaaatgctagtttcagctacgcttgatcgcatggta
acacgccaaattactgatcctgatgaattggttgatttccgtgaaattatggatagtatt
gttcaagattctaatcgtatttatcgagatcttgtcttcggaaatgaacatttctatgat
tacttctttgaagcaagtccaatcaaggaagtatcaagtttaaatattggttctcgtcca
gctgctcgtaagactattactgatatttcaggacttcgtgctattccttgggtattctca
tggtcacaaaaccgtatcatgttaccaggttggtatggtgtgggttctgcctttaatcac
tatattgaagctgaagaaggaaaccttgaaaaacttcaacacatgtttgaaacatggcca
ttcttccgttcacttttgtctaacgtggatatggtgctttcaaaatcagatatgaatatt
gccttccactatgcacagttggcagagagtgaagaagttcgtagcgtctttaacatcatt
ttggatgagtggcagctgactaagaatgtcattcttgcgattgaaaaacatgatgacttc
cttgaagaaagcccatctcttaaagcgagtttgggtttccgattgccatacttcaacgtc
ttgaactacatccaaattgaattgattaaacggcttcgtaataataatctgactgatgac
gaaattagtcttattcatattactatcaatggtattgcaacaggacttcgaaactctggt
taa

DBGET integrated database retrieval system