KEGG   Streptococcus pseudopneumoniae: SPPN_05105Help
Entry
SPPN_05105        CDS       T01590                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
std  Streptococcus pseudopneumoniae
Pathway
std00240  Pyrimidine metabolism
std01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:std00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SPPN_05105
Enzymes [BR:std01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     SPPN_05105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK KdpD AAA_30
Motif
Other DBs
NCBI-ProteinID: AEL10457
UniProt: G0I942
LinkDB All DBs
Position
971699..972289
Genome map
AA seq 196 aa AA seqDB search
MAQLYYRYGTMNSGKTIEILKVAYNYEEQGKSVVIMTSALDTRDGVGYVSSRIGMKRSAI
AIEESTDIFGFIRDLPEKPYCVLVDEAQFLKRHHVYDLARVVDELDIPVMAFGLKNDFRN
ELFEGSKYLLLLADKIDEIKTICQYCKKKATMVLRTQDGLPVYDGEQIQIGGNETYISVC
RKHYFAPEINKENEEK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggcacagttgtattatcgttatgggaccatgaactctggtaagacgattgagattctc
aaggtggcctataactacgaggagcagggaaaaagtgttgtgattatgacctcggctctg
gatactcgtgacggtgttggctatgtgtcgagtcgtattggcatgaaacgctctgccatt
gcaattgaggagtcaacagatatttttggatttatccgagatttacctgagaaaccatac
tgtgttttggtcgatgaagcccagtttctcaaacgtcatcatgtttatgacctagctcgt
gttgtagacgagttagacatacccgttatggcatttggtttgaaaaatgactttcgcaat
gaattgttcgaaggttccaagtatctcttgcttttagcagacaagatcgacgaaatcaag
actatttgccagtattgcaagaaaaaggcaaccatggtgttgcgtacgcaagatggactg
cccgtttacgatggtgagcagattcagattggtggcaatgaaacctatatctcggtttgc
cgtaaacattattttgcgcctgaaatcaataaggagaatgaagaaaaatga

DBGET integrated database retrieval system