KEGG   Streptococcus pseudopneumoniae: SPPN_07310Help
Entry
SPPN_07310        CDS       T01590                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
std  Streptococcus pseudopneumoniae
Brite
KEGG Orthology (KO) [BR:std00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:std03012]
    SPPN_07310
   03029 Mitochondrial biogenesis [BR:std03029]
    SPPN_07310
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:std04147]
    SPPN_07310
Translation factors [BR:std03012]
 Eukaryotic Type
  Elongation factors
   SPPN_07310
 Prokaryotic Type
   SPPN_07310
Mitochondrial biogenesis [BR:std03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    SPPN_07310
Exosome [BR:std04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SPPN_07310
  Exosomal proteins of breast cancer cells
   SPPN_07310
  Exosomal proteins of colorectal cancer cells
   SPPN_07310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase GrpE
Motif
Other DBs
NCBI-ProteinID: AEL10888
UniProt: G0IB27
LinkDB All DBs
Position
complement(1395785..1396981)
Genome map
AA seq 398 aa AA seqDB search
MAKEKYDRSKPHVNIGTIGHVDHGKTTLTAAITTVLARRLPSSVNQPKDYASIDAAPEER
ERGITINTAHVEYETEKRHYAHIDAPGHADYVKNMITGAAQMDGAILVVASTDGPMPQTR
EHILLSRQVGVKHLIVFMNKVDLVDDEELLELVEMEIRDLLSEYDFPGDDLPVIQGSALK
ALEGDSKYEDIVMELMNTVDEYIPEPERDTDKPLLLPVEDVFSITGRGTVASGRIDRGIV
KVNDEIEIVGIKEETQKAVVTGVEMFRKQLDEGLAGDNVGVLLRGVQRDEIERGQVIAKP
GSINPHTKFKGEVYILTKEEGGRHTPFFNNYRPQFYFRTTDVTGSIELPAGTEMVMPGDN
VTIDVELIHPIAVEQGTTFSIREGGRTVGSGMVTEIEA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaaaatacgatcgtagtaaaccacacgttaacattggtactatcggacac
gttgaccacggtaaaactaccctaactgcagctatcacaactgttttggcacgtcgcttg
ccttcatcagttaaccaacctaaagactatgcgtctatcgatgctgctccagaagaacgc
gaacgcggtatcacaatcaacactgcgcacgttgagtacgaaactgaaaaacgtcactac
gctcacatcgacgctccaggacacgcggactacgttaaaaacatgatcactggtgccgct
caaatggacggtgctatccttgtagtagcttcaactgacggaccaatgccacaaactcgt
gagcacatccttctttcacgtcaggttggtgttaaacaccttatcgtcttcatgaacaaa
gttgacttggtagacgacgaagaattgcttgaattggttgaaatggaaatccgtgaccta
ttgtcagaatacgacttcccaggtgacgatcttccagttatccaaggttcagctcttaaa
gctcttgaaggtgactctaaatacgaagacatcgttatggaattgatgaacacagttgat
gagtacatcccagaaccagaacgtgacactgacaaaccattgcttcttccagtcgaagac
gtattctcaatcactggacgtggtacagttgcttcaggacgtatcgaccgtggtatcgtt
aaagtcaacgacgaaatcgaaatcgttggtatcaaagaagaaactcaaaaagcagttgtt
actggtgttgaaatgttccgtaaacaacttgacgaaggtcttgccggagataacgtaggt
gtccttcttcgtggtgttcaacgtgatgaaatcgaacgtggacaagttatcgctaaacca
ggttcaatcaacccacacactaaattcaaaggtgaagtctacatccttactaaagaagag
ggtggacgtcacactccattcttcaacaactaccgtccacaattctacttccgtactact
gacgttacaggttcaatcgaacttccagcaggtactgaaatggtaatgcctggtgataac
gtgacaatcgacgttgagttgatccacccaatcgccgtagaacaaggtactacattctct
atccgtgagggtggacgtactgttggttcaggtatggttacagaaatcgaagcttaa

DBGET integrated database retrieval system