KEGG   Streptococcus thermophilus LMD-9: STER_0437Help
Entry
STER_0437         CDS       T00414                                 

Definition
(GenBank) biotin carboxylase / acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
ste  Streptococcus thermophilus LMD-9
Pathway
ste00061  Fatty acid biosynthesis
ste00620  Pyruvate metabolism
ste00640  Propanoate metabolism
ste01100  Metabolic pathways
ste01110  Biosynthesis of secondary metabolites
ste01120  Microbial metabolism in diverse environments
ste01130  Biosynthesis of antibiotics
ste01200  Carbon metabolism
ste01212  Fatty acid metabolism
Module
ste_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:ste00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    STER_0437
   00640 Propanoate metabolism
    STER_0437
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    STER_0437
Enzymes [BR:ste01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     STER_0437
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     STER_0437
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp ATP-grasp_3 ATP-grasp_4 DUF3182
Motif
Other DBs
NCBI-ProteinID: ABJ65725
LinkDB All DBs
Position
380667..382037
Genome map
AA seq 456 aa AA seqDB search
MFKKLLIANRGEIAVRIIRAARELGIQTVAIYSEADKDSLHTMLADEAICIGPAKSTDSY
LNMNRVLSAAIVTEAQAIHPGFGFLSENSKFATLCEEMNIKFIGPSGEIMDKMGDKINAR
AEMIRANVPVIPGSDGEVFTAEEALEVANRLGYPVMLKASAGGGGKGIRKVNTKEELAPA
FESASQEAKVSFGNGAMYIEKVIYPARHIEVQILGDSYGNIVHLGERDCSLQRNNQKVLE
ESPSVAIGKTLRDEIGSAAVRAAKAVNYENAGTIEFLLDEKSGQFYFMEMNTRVQVEHPV
TEFVSGVDIVKEQIRIAAGEKLSVSQDDIEIKGHAIECRINAENPKFNFAPSPGKISNLY
LPSGGVGLRVDSAVYPGYTIPPYYDSMIAKIIVHGENRFEALMKMQRALYEFEIDGVVTN
ADFQLDLISDRSVIAGDYDTSFLMETFLPEYQNREG
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaaaattattgattgccaatcgtggtgaaattgcagtgcgtattatccgtgca
gcgcgtgaattgggtatccaaacggtcgctatctattctgaggcggataaggattctctc
catactatgcttgctgatgaagctatctgtattggtccggcaaaatcaactgattcttat
ttgaatatgaaccgtgtcttgtcagcagctattgtaactgaggctcaagctattcatcca
gggtttggtttcttgagtgaaaactctaaatttgctactctctgtgaggaaatgaacatc
aagtttattggtccttcaggtgagattatggacaaaatgggtgataaaatcaatgctcgc
gctgaaatgattagggctaatgtccctgtaatccctggttcagatggtgaagtctttacg
gctgaagaggctttagaagttgccaatcgtctaggttacccagtgatgcttaaggcttct
gcaggtggtggcggtaaaggaattcgtaaggtcaacactaaagaagagttggctcctgcc
ttcgaatctgcgtcacaggaagctaaagtatcctttggtaatggggcaatgtatattgag
aaagttatttacccagctcgtcatattgaggttcaaattttgggagatagctatggtaat
attgttcacctaggtgagcgtgactgttctcttcaacgtaataaccaaaaggtcttggaa
gaatcaccttctgttgccattggtaagacacttcgtgatgaaattgggtctgcggctgtc
cgtgctgctaaggctgttaattatgaaaatgcgggtactatcgagtttcttcttgatgaa
aaatcaggtcagttttactttatggaaatgaatactcgtgttcaagttgagcacccagtt
actgaatttgtaagtggtgtggatattgttaaagaacaaatccgtattgctgcaggtgaa
aaattatctgtgtctcaagatgatattgaaatcaagggacatgccattgagtgtcgtatc
aatgcggaaaatcctaagttcaactttgcaccaagcccagggaaaattagcaatctctac
ctacctagtggtggtgttggtcttcgtgtggacagtgctgtctatccaggctataccatt
ccaccttactatgattcaatgattgcaaaaatcattgttcatggagaaaatcgatttgag
gcactcatgaagatgcaacgtgctctttacgagtttgaaatcgatggagttgtgacaaat
gctgacttccagttagatttgatttcagaccgtagcgttatcgctggggattatgacaca
tcattcttgatggaaactttcctaccagaatatcagaatcgtgagggatag

DBGET integrated database retrieval system