KEGG   Streptococcus thermophilus LMD-9: STER_0762Help
Entry
STER_0762         CDS       T00414                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ste  Streptococcus thermophilus LMD-9
Brite
Enzymes [BR:ste01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     STER_0762
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ABJ66015
LinkDB All DBs
Structure
PDB: 

Position
695677..696282
Genome map
AA seq 201 aa AA seqDB search
MAIILPDLPYAYDALEPYIDAETMTLHHDKHHATYVANANAALEKHPEIGEDLEALLADV
EKIPADIRQALINNGGGHLNHALFWELLSPEKQEPTAEVAAAINEAFGSFEAFQEVFTTA
ATTRFGSGWAWLVVNAEGKLEVVSTPNQDTPISDGKKPILALDVWEHAYYLKYRNVRPNY
IKAFFEIINWNKVAELYAEAK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggctattattcttccagatcttccttacgcttacgatgctttggaaccatacattgat
gctgaaacaatgactcttcatcatgacaaacaccatgcaacttacgtggcgaatgctaat
gctgcgcttgaaaaacaccctgaaattggtgaggaccttgaagcgcttttggctgatgta
gaaaaaattccagcagacattcgtcaagcacttattaacaatggtggtggacatcttaac
cacgcacttttctgggaacttttgtcaccagaaaaacaagaaccaactgcagaagtagca
gccgctattaacgaagcattcggttcatttgaagctttccaagaagttttcactacggca
gcgacaactcgttttggttcagggtgggcatggcttgtggttaacgcagaaggtaaactt
gaagttgtttcaactcccaaccaagatacacctatctcagacggtaaaaaaccaatcttg
gcacttgatgtttgggaacatgcttactacctaaaataccgtaacgtacgtccaaactac
atcaaagccttctttgaaatcatcaattggaataaagttgccgagctttacgcagaagct
aaataa

DBGET integrated database retrieval system