KEGG   Streptococcus thermophilus LMD-9: STER_1500Help
Entry
STER_1500         CDS       T00414                                 

Definition
(GenBank) neopullulanase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
ste  Streptococcus thermophilus LMD-9
Pathway
ste00500  Starch and sucrose metabolism
ste01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ste00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    STER_1500
Enzymes [BR:ste01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     STER_1500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF1939 Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: ABJ66655
LinkDB All DBs
Position
1403400..1404851
Genome map
AA seq 483 aa AA seqDB search
MTNQTAMQYFEWYLPSDGQHWNNLAEDAQHLADLGISHVWMPPAFKATNKDDVGYGVYDL
FDLGEFDQKGTIRTKYGLKEEYLNAINQLKNVGIIPMADVVLNHKAAADKLETFYVVEVD
PEDRTKVISEPFEIEGWTHFTFDGRQKAYNDFEWHWYHFNGTDFDAKRNKKGIYLIQGDN
KGWAHNDLVDNENGNFDYLMFANLDYRHPEVIENIYEWADWFVETTGVQGFRMDAIKHID
YFFMRNFIRDVKEKQGQDFYVFGEFWNAKEEDNNTYLEKTENRFDLVDVRLHYNLYDASL
KGADYDLTTIFEQTLVKNHPEHAVTFVENHDTQRGQALESTVEEWFKPSAYALILLRKDG
LPCLFYGDYYGIDGEFAQESFKEVLDTLLYARKDLAYGEQTDYFDDPNCIGWTRSGNEDC
TPLAVTISNDAANNKSMEIGSDWAGQTFYDILGNCSDTVTIDEDGWGDFPVSEKSVSVWT
IQD
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatcaaactgcaatgcaatactttgaatggtatctcccaagtgacggccagcat
tggaacaacttagctgaagatgcccaacatctagcagaccttggcatcagccatgtttgg
atgccacctgctttcaaagctactaacaaagatgatgttggttacggagtctatgacctc
tttgaccttggggaattcgaccaaaaaggaaccatacgcaccaaatatggtctcaaggaa
gaataccttaatgccatcaaccaactcaaaaatgttggtatcatccctatggccgatgtt
gtgctcaaccacaaggcagccgcggataaacttgaaaccttttatgtggtagaagttgac
cctgaggaccgtaccaaagtaatcagcgaaccgtttgaaatcgagggttggactcatttc
acttttgacggacgtcagaaagcttacaacgactttgaatggcactggtaccactttaat
gggactgacttcgatgccaaaagaaataaaaaaggtatctatcttatccaaggtgacaac
aaaggctgggcacataatgacttggttgacaatgaaaatggtaactttgactaccttatg
tttgccaacctagattataggcatcctgaagttatagaaaatatttacgaatgggctgac
tggttcgtcgaaacaactggtgtccaaggtttccgaatggatgccatcaagcacattgat
tatttctttatgcgtaattttattcgcgacgtcaaagaaaaacaaggtcaagatttctat
gtttttggtgaattttggaatgccaaggaagaggataataatacttatctcgaaaaaact
gaaaaccgctttgatcttgtggatgttcgccttcattacaatttatatgatgccagcctc
aaaggagcagattacgatttgacgactattttcgaacaaacattggtcaaaaatcaccct
gagcatgcggtaaccttcgtagagaaccatgacacccaacgtggacaagcattggaatct
actgttgaagaatggtttaaaccatctgcctatgccctcatccttcttcgtaaagacggc
cttccttgcctattttatggtgactactatggcattgatggtgagtttgctcaagaaagt
ttcaaagaggtcctagacaccttactttacgctcgtaaagatttggcttatggagagcaa
acagactactttgacgaccctaactgtattggatggacacgctctggtaatgaagactgt
actccattagccgtaaccatttctaatgatgctgccaacaacaaatctatggaaattgga
agtgactgggctggacaaactttctatgatattcttggaaactgctctgatactgtaaca
attgacgaagacgggtggggagacttcccagtctctgaaaaatctgtcagcgtttggaca
attcaagactaa

DBGET integrated database retrieval system