KEGG   Sporolactobacillus terrae: C0679_03030Help
Entry
C0679_03030       CDS       T05792                                 

Definition
(GenBank) methionine gamma-lyase
  KO
K01761  methionine-gamma-lyase [EC:4.4.1.11]
Organism
stea  Sporolactobacillus terrae
Pathway
stea00270  Cysteine and methionine metabolism
stea00450  Selenocompound metabolism
stea01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stea00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    C0679_03030
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    C0679_03030
Enzymes [BR:stea01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.11  methionine gamma-lyase
     C0679_03030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Met_gamma_lyase Aminotran_5 Aminotran_1_2 DegT_DnrJ_EryC1 Beta_elim_lyase SelA GDC-P
Motif
Other DBs
NCBI-ProteinID: QAA24653
UniProt: A0A410D6H6
LinkDB All DBs
Position
599045..600232
Genome map
AA seq 395 aa AA seqDB search
MELNTDVLHAEQRRDVAFGSHVSPLYQTSTFVLHDFDEAVHLNQNIDQGFVYSRFGNPTV
DEFERKIAYLEHAEAALGLASGLGAISTAVMSVIKGGDHIIFGDVIYGCTFALFTKVLPD
FHVDYTIVDTTDPEAIAAAIRPNTKLVYVETPANPTLKISDIQAIADLVHQHEGIRLIVD
STFASPYLQNPLDLGADLVVHSATKYLCGHGTVTAGVIAGSKALIDQARMPYLQCFGAVL
DPFAAWQIMQGMKTLGVRMERHCENAMKVANFLEGHPMIDHVYYPGLPSHPSHETAKKQM
RGFGGMMSADIKGGIDAVRKVMNATKVFSLATSLGNVDSLIQHSPSMSHFDMTPEERHRV
SIYDGQVRLSVGIEDADDLIHDLDQALSKIDVCVN
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggaattgaatacagatgttcttcatgcggagcagcgtcgggatgttgcttttgggtcg
catgtcagtccgttgtaccaaacgtcaacgtttgtgctgcatgactttgatgaggcagtg
cacttgaatcagaatattgatcaggggtttgtgtatagtcgtttcggtaatccaacggtg
gatgagttcgaacggaaaattgcttatctcgagcatgcggaggctgcactaggtttggct
tcggggcttggtgcgatttcgacggcagttatgtcggtgattaagggtggcgatcatatc
atttttggtgatgtgatctatggttgcacctttgctttgtttacaaaagtacttcctgat
tttcatgttgactatacgattgttgatacaaccgacccagaagcaattgcagctgcgatt
cgaccgaacacaaagctggtttatgttgagacaccggccaatccaacgctgaagatcagt
gacatccaagcaattgccgatcttgtccatcagcatgagggcattcgattaattgttgac
agcacatttgcttctccgtatctccagaatccgcttgatttgggtgctgatttggttgta
cacagtgccacgaaatatctgtgtgggcatggaacggtcacagccggcgttattgcggga
agcaaggcattgattgatcaagcgcggatgccttatttgcaatgctttggtgcggtgctc
gatccgtttgctgcatggcagatcatgcaaggcatgaagacgctgggggtgcgcatggag
cgccattgcgagaatgcaatgaaggttgcaaacttcctggagggacatccgatgattgat
catgtctactatccgggactcccgtctcatccgagccatgaaacggcgaaaaaacaaatg
cgcggattcggcggcatgatgagtgccgatatcaaaggcgggattgatgcggtgcgtaaa
gtgatgaatgcgacaaaggtattcagcttagcgacgagccttggaaacgtcgactctttg
attcagcattcaccttccatgagtcacttcgacatgacgccggaggaacgccaccgcgtc
agtatctatgacgggcaggttcggctgtcggttggtattgaggatgccgacgacttaatt
catgatttagaccaggcactgagtaaaattgatgtttgtgtaaactaa

DBGET integrated database retrieval system