KEGG   Sporolactobacillus terrae: C0679_04495Help
Entry
C0679_04495       CDS       T05792                                 

Gene name
flgM
Definition
(GenBank) flagellar biosynthesis anti-sigma factor FlgM
  KO
K02398  negative regulator of flagellin synthesis FlgM
Organism
stea  Sporolactobacillus terrae
Pathway
stea02020  Two-component system
stea02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:stea00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    C0679_04495 (flgM)
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    C0679_04495 (flgM)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:stea02035]
    C0679_04495 (flgM)
Bacterial motility proteins [BR:stea02035]
 Flagellar system
  Flagellar assembly proteins
   Regulation
    C0679_04495 (flgM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FlgM
Motif
Other DBs
NCBI-ProteinID: QAA24912
UniProt: A0A410D749
LinkDB All DBs
Position
929940..930206
Genome map
AA seq 88 aa AA seqDB search
MKINRYQPIQNYTTNYQAAKRGETPSTTRNTSDKVEISPTAKRLQGTDKLERARQEKVER
LKQQIENGTYQVSSKSIAEKMYGFWNNK
NT seq 267 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaattaatcgctaccagccgatacaaaattacacgactaattatcaggcggcaaaa
cgcggcgaaacgccaagtacaacgcgtaataccagtgataaagttgaaatatcgccaacc
gcaaaacgattacagggcacagataaactggagcgcgccagacaagaaaaggtagagcgc
ttaaaacagcaaatcgaaaacggcacgtatcaagtctcgtcaaaaagtattgctgagaaa
atgtacggattctggaacaataaataa

DBGET integrated database retrieval system