KEGG   Sporolactobacillus terrae: C0679_13190Help
Entry
C0679_13190       CDS       T05792                                 

Definition
(GenBank) lactate racemization operon protein LarA
  KO
K22373  lactate racemase [EC:5.1.2.1]
Organism
stea  Sporolactobacillus terrae
Pathway
stea00620  Pyruvate metabolism
stea01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stea00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    C0679_13190
Enzymes [BR:stea01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.1  lactate racemase
     C0679_13190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lar_N DUF362
Motif
Other DBs
NCBI-ProteinID: QAA26447
UniProt: A0A410DBH6
LinkDB All DBs
Position
complement(2728605..2729879)
Genome map
AA seq 424 aa AA seqDB search
MVRIELPYDKTTLVADLPDNNFAGKLISEAATYHADRSENAIVEESLDHPIGSLPLEALA
KGKKNIVIISSDHTRPVPSHIITPILLRHLREAAPEARIRILVATGFHRPSTREELVNKY
GQKIVDEEEIVMHISTDDASMVKIGQLPSGGECIINKVAAEADLLLSEGFIESHFFAGFS
GGRKSVLPGIASYKTIMANHSGPFINSDKARTGNLHHNPIHEDMVYAARKAKLAFIVNVV
LDEDKKIIGSFAGDMEAAHQKGCEFLQGLSRVKKIDCDIAISTNGGYPLDQNIYQAVKGM
TAAEATNKEGGTIIMVAGCRDGHGGEGFYHNLADISDPKAFLDRAINTPKLKTIPDQWTA
QILARILVHHHVIMVSDLVEPDLITDMHMSLATSLDQALEMAYEREGKDAKIVVIPDGLG
VIVR
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggttcgaattgaactgccttatgacaaaacaacgcttgttgctgatttgcccgacaat
aactttgctggaaagttaatctctgaagcggcaacctatcacgccgatcgatctgaaaat
gcgatcgttgaagaatcactcgaccacccgatcggttcgctgccgctagaagcgttggcc
aagggtaagaaaaatattgtcattattagctccgatcacacgcgtccggtgccttcacac
atcatcacaccaattcttttgcggcatttgcgtgaagccgctccggaagcccgcattcgt
attctcgttgccaccggttttcatcgcccgtcgacacgcgaggaacttgttaacaaatat
ggacaaaaaatcgtggatgaagaagaaatcgtaatgcacatttcgacagacgatgcgtcg
atggtcaagatcggccagcttccgtcgggcggcgaatgcatcatcaacaaagtagctgct
gaagccgatttactgctttcggaaggatttattgaatcgcatttctttgctggattttcc
ggcggccgtaaatcggtgcttccgggaattgcttcctacaagacgattatggccaaccat
tccggtccatttattaattccgataaagcacgtaccggtaacctgcatcacaacccgatt
catgaggatatggtgtatgcagcgcgcaaggcaaaacttgcttttattgtcaatgttgtg
ctcgatgaagataagaaaatcatcggatcgtttgccggagatatggaagcggcgcatcaa
aaaggttgtgaatttctgcaagggttgtcgcgagtaaaaaaaattgactgcgacatcgcg
atctcgacaaacggcgggtatccgcttgaccagaacatctatcaggccgttaaaggcatg
acagctgccgaggcaaccaataaagaaggcgggacgatcatcatggttgccggttgccgg
gacggacacggcggcgaagggttttatcacaatcttgccgatatttccgatccaaaagca
ttcttggatcgtgccattaataccccgaagttgaaaacgattccggatcaatggaccgcg
cagatcttggcacgaattttggttcatcatcatgtcatcatggtttccgatctcgttgaa
ccggatttgatcacggacatgcatatgtcgcttgcgacgtcgctcgatcaagcattggag
atggcgtacgaacgtgaaggcaaggatgccaagattgttgtgatccccgatggtttaggc
gttattgtgcgctaa

DBGET integrated database retrieval system