KEGG   Sporolactobacillus terrae: C0679_15395Help
Entry
C0679_15395       CDS       T05792                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
stea  Sporolactobacillus terrae
Brite
KEGG Orthology (KO) [BR:stea00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C0679_15395
Enzymes [BR:stea01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     C0679_15395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA HI0933_like DAO Thi4 FAD_oxidored K_oxygenase FAD_binding_3 NAD_binding_8 NAD_binding_7 AlaDh_PNT_C Glutaredoxin FMO-like
Motif
Other DBs
NCBI-ProteinID: QAA26836
UniProt: A0A410DCN9
LinkDB All DBs
Position
3192321..3193850
Genome map
AA seq 509 aa AA seqDB search
MVLEAAIKNQLNQYLQLMEGNVQLKVSAGSDQLSKDLLAFIDEIASLSSQITVEKASLPR
TPSFSVNRPGEDTGITFAGIPLGHEFTSLVLALLQVSGRAPKVDQGVIDQIKKISGEYHF
ETYVSLSCHNCPDVIQALNVMSLLNPNISNTMIDGASFKEEAESKDIMAVPAVYLNGEFF
NGGRISLEEILAKLGSAPDSSALSNKDPFDVLVVGGGPSGASAAIYTARKGLRTGVVAER
FGGQIQETLGIDNFISVKHTEGPKLAASLEEHVKDYDVDVMNLQRAKDIKKNDLFEVELE
SGAVLKSKAVILSTGARWRNVNVPGEQEFKNKGVAYCPHCDGPLFEGKDVAVIGGGNSGI
EAAIDLAGIVKHVTVLEFMPELKADEVLQKRLYSLPNVTVLKNVQTKEITGTDKVTGITC
VDRATQEETHIELQGVFVQIGLVPNTDWLEGTVERTRVGEIIVDKYGATSVPGLYAAGDC
TNSPYKQIIISMGSGATAALGAFDYLIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggtgctcgaagcagctattaagaatcaattaaaccaataccttcaactcatggaaggt
aacgttcagcttaaagtcagtgccggatctgatcaattgtcaaaggacctgttggctttt
atcgacgagatcgcttccttatcttcccaaatcacggttgaaaaagcatcgcttccaaga
acgccaagcttcagtgtcaaccgtcctggagaagataccggcatcacgttcgcaggtatt
cctcttggtcacgaatttacatcactcgtattggccttgttacaggtgagcggaagggcg
ccaaaggttgatcagggcgtcattgatcaaattaagaagataagcggtgaataccacttt
gaaacttacgtcagcctcagctgtcacaattgccctgatgttattcaggcattaaacgtg
atgagccttctgaaccccaacatctcaaatacgatgattgatggggcatcctttaaagaa
gaagcagaaagcaaggacattatggccgtgccggcggtttacttaaatggtgagttcttc
aacggcggtcgaatctcgcttgaagaaattcttgccaaactaggcagcgcacccgattca
tcagcgctttcaaataaagatccttttgatgtactcgttgttggtggcggtccttcaggg
gcaagtgcggcgatttataccgcacgaaaaggattgcgtacaggggttgttgcggaacgc
ttcggtggccagattcaggaaacattgggtatcgacaactttattagtgtgaaacatact
gaaggtccaaaactcgcagccagtcttgaagaacatgttaaggactatgatgtcgacgtc
atgaaccttcagcgcgccaaggatatcaaaaagaacgatctttttgaagtagaacttgag
agcggtgcggtgctcaaaagtaaagccgtcattctatccaccggcgcacgttggcgcaat
gttaacgtacccggtgaacaagaattcaaaaacaaaggggtcgcttattgcccacattgt
gacggtcctttatttgaaggaaaggacgtagccgttatcggcggtggtaattccggcatt
gaagccgctattgacctagcaggtattgtaaaacatgtgaccgttcttgaattcatgcca
gagctcaaagctgatgaagtgctgcagaaacgtctttacagcctccctaatgttaccgtc
ttaaagaacgttcaaacaaaagaaatcaccggtaccgataaagtaaccggcattacctgt
gttgatcgcgcaacccaagaagaaacacatatcgaattacaaggcgtatttgttcaaatc
ggtcttgtaccaaataccgattggttagaaggaactgttgagcgtacacgcgtcggcgag
atcattgtcgataagtacggcgcaaccagtgttcccggattgtatgccgcaggtgattgc
accaacagtccctataaacaaatcatcatttcaatggggtcaggagcaaccgctgctctc
ggtgcattcgattacctgatcagaaattaa

DBGET integrated database retrieval system