KEGG   Sporomusa termitida: SPTER_29990Help
Entry
SPTER_29990       CDS       T06115                                 

Gene name
ydjJ
Definition
(GenBank) putative zinc-type alcohol dehydrogenase-like protein YdjJ
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
sted  Sporomusa termitida
Pathway
sted00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:sted00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SPTER_29990 (ydjJ)
Enzymes [BR:sted01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     SPTER_29990 (ydjJ)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     SPTER_29990 (ydjJ)
    1.1.1.-  
     SPTER_29990 (ydjJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc F420_oxidored 2-Hacid_dh_C AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: QDR81592
LinkDB All DBs
Position
complement(3117701..3118756)
Genome map
AA seq 351 aa AA seqDB search
MKAAVWYGQKDVRVMDVPEPPSPPAGWVKVKVQWCGICGSDLHEYLAGPIFIPVDKPHAL
TGSTAPIILGHEFSGDVVEVGPGVTNVAIGDRVAPDACQVCWECPRCREHRYSLCEKLAF
TGLMTDGAFAEYVNVPAYTIYKIPADMSYEAAALIEPLAVGMHAVRRAPLVQGDTAVIMG
AGTIGLATLMCAKAAGASKVYTVEVARARKEYALKAGATAVLDPTEVDVIARVKELTNGG
ADVVFECVGSDKTAPVALELARSAGKVVIVGIFEKASVLNFNALSFTEREVMGSLAYYGE
FAPAIQLVADGRINVEPLITGKISLNDIVEKGFEELVHRKEQNIKVIVKPF
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcagtatggtatggtcaaaaagatgtgcgggttatggatgtccctgagccg
cccagcccgccagccggctgggtcaaggtaaaggtgcagtggtgtggaatttgtggctca
gacctgcacgaatatctcgccggtccgatttttatccctgtagataagccccatgcctta
accggcagtacggcccctatcattctcgggcatgagttttccggcgatgtagtagaggtt
ggacctggtgtaaccaatgtagcaattggcgaccgggtggcgcctgacgcctgtcaggtg
tgctgggaatgcccgcgctgccgggagcatcgctatagtctgtgtgagaaactggctttt
accgggctaatgacggacggggcttttgccgagtatgtaaatgtaccggcctacactata
tacaagatccccgctgacatgtcctatgaggcggccgcccttattgagccgctcgcggta
gggatgcatgccgtgcggcgggcgcccctggttcagggggacacagcggtaattatgggg
gccgggacaatcggtcttgctaccctgatgtgcgccaaggcggccggggccagtaaggta
tatacggtagaggtggccagggccaggaaggaatatgccttaaaggccggggccacggct
gttttggacccgacagaggtcgatgtgattgccagggtgaaggagctaaccaatgggggc
gccgatgtagtttttgagtgtgtgggcagcgataaaacggcccctgtggccctcgaactg
gcccgttccgccggtaaggtggttattgtgggcatcttcgaaaaagcctctgtgctgaat
ttcaacgcgttgtcctttaccgaaagagaggttatgggctctttggcttattacggtgag
tttgcgccggcgattcagcttgtagctgacggccggattaacgttgagccgctgattacc
ggtaagataagccttaatgacattgtcgaaaaggggtttgaagagctggtacatcgcaaa
gaacaaaatatcaaggttattgtaaaaccgttttaa

DBGET integrated database retrieval system