KEGG   Sporomusa termitida: SPTER_41400Help
Entry
SPTER_41400       CDS       T06115                                 

Gene name
ahpF_2
Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sted  Sporomusa termitida
Brite
KEGG Orthology (KO) [BR:sted00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SPTER_41400 (ahpF_2)
Enzymes [BR:sted01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SPTER_41400 (ahpF_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 AlaDh_PNT_C HI0933_like Glutaredoxin FAD_oxidored FAD_binding_3 Thi4 DAO K_oxygenase FMO-like
Motif
Other DBs
NCBI-ProteinID: QDR82710
UniProt: A0A517DZB5
LinkDB All DBs
Position
complement(4381138..4382667)
Genome map
AA seq 509 aa AA seqDB search
MLLDQDIKEQLAQYLQLLEANVLIKVSAGSDDVSSDLIALVDEIASMSPLITVEKTELPR
TPSFSINRPGEDNGITFAGIPLGHEFTSLVLALLQVSGRAPKVEQKIIDQIQGLTGKYHF
ESYISLTCHNCPEVVQALNLMSVLNPDITHTMVDGAVFQEEVQAKNVMAVPAVYLNGEFF
GSGRMEIEEILAKLSDGSAVSELAEKEPFDILVVGGGPAGASAVIYAARKGIRTGIVAEQ
FGGQVKDTLGIENFISIKYTEGLKLAANLEEHVKEYQVDVMKRQRGRRLTKKELVEIELE
TGAVVKSKAVILATGARWRSIGVPGETEFKNKGVAYCPHCDGPLFKGKRVAVIGGGNSGV
EAAIDLAGIVEHVTVLEFMPDLKADVVLQQRLYSLPNVTVVKNVQTKEITGREKVDGLSY
TDRSTGESYHLELQGVFILIGLIPNTDWLRDTIECNRFGEIIVDSHGATNVPGVFAAGDC
TNTPYKQIIIAMGSGANAALGAFDYLIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgttgttagaccaggatataaaagaacaattagctcaatatcttcagttgctggaagcg
aatgtgctaattaaagtgagtgcaggcagcgatgatgtatccagcgacctgattgccctg
gtggatgagatagcctctatgtcgcccctgatcacagtcgagaaaacagagctgccaaga
acgcccagtttcagtatcaatcgcccgggagaagacaacggcataacatttgccggtatt
ccgctgggacatgagtttacctctttggtgctggccttgctgcaggtcagcggcagagcg
ccgaaggtggagcaaaagataatcgatcagattcaagggcttacaggcaagtatcatttt
gaatcttatatcagcctgacctgccataattgcccggaggttgtccaggctctgaacctt
atgagtgttcttaatccggacattacgcataccatggtggatggtgctgtttttcaggag
gaagtgcaggcgaaaaatgttatggcggtgcctgcggtctatcttaatggtgaatttttt
ggcagcggccgtatggagatcgaggaaatactcgccaaactcagcgatggttctgctgtg
tccgaattggcagaaaaagagccctttgatattctggttgtgggcggcggcccggccgga
gccagcgcggttatttacgcggccaggaaaggaattcgcaccgggattgtcgccgaacag
ttcggcggtcaggttaaggataccctgggcattgaaaactttatcagtataaaatatacc
gaaggtcttaagctggcggctaatctcgaggaacatgtgaaagaatatcaggttgatgta
atgaagcggcagcgcggccggcgtttgacgaagaaagaactggtggaaattgaactggaa
actggcgctgtcgtaaaaagtaaagcggttattcttgctacaggagcccgctggcgcagt
attggcgtaccgggagaaactgagtttaagaataaaggggtggcctactgccctcattgt
gatggcccattgtttaaaggaaaacgggtggccgttatcggcggcggcaactccggggta
gaggcggcgattgatttggccggcattgtggagcatgtgactgtgctcgaatttatgccg
gacctgaaagcggatgttgtcctgcagcagcgtttgtacagtttaccgaatgtgacggtt
gtaaaaaatgtgcaaacaaaagaaatcaccggcagggaaaaggtcgatggcctttcctac
acggaccgcagtaccggagaaagctatcacctggaactacagggggtatttatcctgatc
gggcttattccgaataccgattggctgcgggatacaatagaatgcaaccgctttggcgag
attattgtagacagccatggcgcgaccaatgtgccgggggtatttgccgcgggtgactgc
acgaacactccttataagcagattattattgctatggggtctggcgcgaatgcggccttg
ggcgcatttgactatctaatacggaattga

DBGET integrated database retrieval system