KEGG   Stenotrophomonas sp. KCTC 12332: AXG53_00500Help
Entry
AXG53_00500       CDS       T04408                                 

Definition
(GenBank) MFS transporter
Organism
stek  Stenotrophomonas sp. KCTC 12332
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sugar_tr MFS_1 TRI12 MFS_1_like
Motif
Other DBs
NCBI-ProteinID: AMJ55276
UniProt: A0A126NE90
LinkDB All DBs
Position
complement(112713..114122)
Genome map
AA seq 469 aa AA seqDB search
MNQATTGGENTRLIVLISVVATIGGFLFGFDSGVINGTQDGLHQAFKSGEWMQGFEIASM
LLGCAVGAFSAGRLSDNLGRRNVLIISAVMFLLSAIGAGAAASSAWFIVARVVGGFAVGA
ASVISPAYIAEVAPARYRGRLATVQQIAIISGLTAAFLSNYLLAAKAGASTEALWGGHAA
WRWMFWMQAVPSLLFLLLLLTIPESPRYLVVKRRKEDALRVLTRLFGATGAQAKLEEIDA
SLSTDHHRPQLSDLKNKATGKIRPIVWVGIGLATFQQLVGINVVFYYGAVLWQAVGFSEN
DALLINVLSGALSIGACIVTVLLIDRIGRKPLLWVGSAGMAASLALVVIAFASGSLVDGH
LQLPGRMGTLALVAANAYVVFFNLSWGPVMWVMLGEMFPNQIRGSALAVAGAAQWTSNFA
VTVTFPILLAATGLAATYSIYLVAAVISVFFVLKYVHETKGKELEQMEG
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaggcaacgaccgggggtgagaacacccggctgatcgtactgatcagcgtagta
gcgacgattggcggattcctgttcggattcgacagcggggtcatcaatggcacacaggat
ggcctgcaccaggcgttcaagtccggcgagtggatgcagggcttcgagatcgcttcgatg
ctgctcggctgcgcggtgggtgcgttcagcgccggccggctgtccgataatctgggccgg
cgcaatgtgctgatcatctcggcggtcatgttcctgctgtcggcaattggtgccggcgcg
gccgcgtcgtcggcctggttcatcgttgcgcgggtggtgggcggttttgcggtcggcgcg
gccagcgtcatttcgccggcctatatcgccgaggtcgcacccgcgcgctaccgtggccgg
ctcgccacggtccagcagatcgccatcatcagcgggctcaccgccgcgttcctgtccaat
tacctgctggccgccaaggccggcgcctccaccgaggccttgtggggcggtcacgccgcg
tggcgctggatgttctggatgcaggcggtgccatcgctgctgttcctgctgctgttgctg
accatcccggaaagcccgcgctacctggtggtcaagcgccgcaaggaagatgcgctgcgc
gtgcttacccggctgttcggtgccaccggtgcgcaggccaagctggaggaaatcgacgca
tcgctctctaccgatcaccaccgtccgcagctctccgacctgaagaacaaggctaccgga
aagatccgcccgatcgtttgggtcggcatcggcctggccaccttccagcagctggtcggc
ataaatgtggtgttctattacggggccgtgttgtggcaggcggtcggcttctcggagaac
gacgcactgctgatcaacgtcctgtccggtgcgctcagcatcggtgcctgcatcgtcacc
gtgctgctgattgaccgcatcggccgcaagccgctgctgtgggtgggctcggccggcatg
gcggcttctttggcgctggtggtgatcgcatttgcgagcggctcgctggtcgacggccat
ctgcaattgcccggccgcatgggcacgctggcgctggtggccgccaatgcctacgtggtg
ttcttcaacctgtcttggggcccggtgatgtgggtgatgctgggcgagatgttccccaac
cagatccgtggttcggcactggccgtggccggtgcggcgcaatggacatctaactttgcc
gtgacggtgacattcccgatcctgctggcggcaaccgggttggcggcgacctacagcatc
tacctggtggcggccgtcatttcggtgttcttcgtactcaagtacgtgcacgaaaccaag
ggcaaggaactggagcagatggagggatga

DBGET integrated database retrieval system