KEGG   Stenotrophomonas sp. KCTC 12332: AXG53_05890Help
Entry
AXG53_05890       CDS       T04408                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
stek  Stenotrophomonas sp. KCTC 12332
Pathway
stek00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:stek00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AXG53_05890
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:stek02000]
    AXG53_05890
Enzymes [BR:stek01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AXG53_05890
Transporters [BR:stek02000]
 Other Transporters
  Pores ion channels [TC:1]
   AXG53_05890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_C GST_C_3
Motif
Other DBs
NCBI-ProteinID: AMJ56230
UniProt: A0A126NH14
LinkDB All DBs
Position
complement(1389418..1390056)
Genome map
AA seq 212 aa AA seqDB search
MASTSDEIVFYTNPMSRGRIVRWMLEELGQPYRTEVLEFGKSMKAPAFLAINPMGKVPTI
VHRGVVVSEAAAICTYLADAFPAAGLAPALDDPLRGSYLRWLFFAAGPVEAAISAKACGG
LPPPEKAGTVGYGSFEQMTDTLEQAAAGAAPWLLGDRFSAADVYVGSQVLWGQMFKTLPE
RDAFAAYGERLRNRPAWQRAAALDDALIPPRA
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggccagcacatcagacgaaatcgtcttctataccaatccgatgtcgcgtggtcggatc
gtgcgctggatgctggaagaactggggcagccgtaccgcaccgaggtgctggagttcggc
aaaagcatgaaagcgccggctttccttgccatcaacccgatgggcaaggtgcctaccatc
gtgcaccgcggcgtggtggtgagcgaggcggcggcgatatgcacctatctggccgacgca
ttccccgcggctggtctggcaccggcgctggacgatccgctgcgtggcagctatctgcgc
tggttgttctttgctgccggcccggtggaagcggcgatcagcgccaaggcctgtggcgga
ctaccgccgccggagaaagcgggaacggtcggctatggcagttttgaacagatgaccgat
accttggagcaggccgccgccggcgccgctccctggttgctgggcgaccgcttcagcgcc
gccgacgtctacgtggggagccaggtgctgtgggggcagatgttcaagaccttgcccgag
cgcgatgccttcgccgcctacggggaacgcctgcgcaaccgtccggcatggcagcgtgcc
gccgcgctggacgacgcgctgattccgccgcgcgcctga

DBGET integrated database retrieval system