KEGG   Stenotrophomonas sp. KCTC 12332: AXG53_13850Help
Entry
AXG53_13850       CDS       T04408                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
stek  Stenotrophomonas sp. KCTC 12332
Brite
KEGG Orthology (KO) [BR:stek00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AXG53_13850
Enzymes [BR:stek01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AXG53_13850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 FAD_oxidored DAO Glutaredoxin HI0933_like FAD_binding_3 AlaDh_PNT_C K_oxygenase NAD_binding_8 Thioredoxin_4 FMO-like Thi4
Motif
Other DBs
NCBI-ProteinID: AMJ57590
UniProt: A0A126NKS2
LinkDB All DBs
Position
3216793..3218385
Genome map
AA seq 530 aa AA seqDB search
MLDANLQTQLKTYLERVTRPIHITAHADDGEKSQEMMELLNTLVTLSDKITLDVRRDGQG
RVPSFDLDSPGQNIGLTFAGLPMGHEFTSFVLALLQVGGHPSKESAELLEQIRDLKGEYR
FETYFSLSCQNCPDVVQALNLAAALNPNITHVAIDGALFQDEVEQRQVMSVPTVYLNGEV
FDQGRMSLEQIVAKLDTGAAARDAEKIKAKDAFDVLVVGGGPAGAAAAIYAARKGIRTGV
AAERFGGQVLDTMGIENFISVQHTEGPKLAAALEAHVREYEVDIMNLQRATKLVPAGADG
LVEVQLENGASLKSKTVILSTGARWRQMNVPGENEYRNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVSHVTVFEFDSKLRADQVLQAKLNSLPNVKVVLNAQTTEVLGDG
QRVNGLVYTDRVGGDSHRVELEGIFVQIGLLPNTEWLRGTVELSDRGEIIIDDRGQTNVP
GVFAAGDCTTVPYKQIVIAMGAGSTAALSAFDHLIRTPVLQPATAVEETA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgttggatgccaacctgcagacccagctcaagacctacctggaacgggttacccgcccg
atccacatcaccgcgcacgccgatgacggcgaaaagtcgcaggagatgatggagctgctc
aacacgctggtcaccctgtcggacaagatcacgctggacgtgcgccgtgacggccagggc
cgcgtgccttcgttcgacctcgacagcccgggccagaacatcggcctgaccttcgccggc
ctgccgatgggccacgaattcacctccttcgtgctggccctgctgcaggtcggcggccat
ccgtccaaggaatcggccgagctgctggagcagatccgcgacctgaagggcgagtaccgc
tttgaaacctatttctcgctgtcctgccagaactgcccggacgtggtgcaggcgctgaac
ctggccgcagcgctgaaccccaacatcacccatgtcgccatcgacggcgccctgttccag
gacgaggtcgagcagcgccaggtgatgtcggtgccgaccgtctatctcaacggcgaagtg
ttcgaccagggccgcatgagcctggagcagatcgtcgccaagctggataccggtgccgcc
gcgcgtgatgccgaaaagatcaaggccaaggatgctttcgacgtgctggtggtgggcggt
ggcccagccggtgccgcggcggcgatctatgccgcgcgcaagggcatccgcaccggtgtt
gctgccgagcgtttcggtggccaggtgctggacaccatggggatcgagaacttcatctcg
gtgcagcacaccgaaggcccgaagctggccgccgcgctggaagcccacgtacgcgagtac
gaggtggacatcatgaacctgcagcgcgccaccaagctggtgccggccggtgccgatggc
ctggtcgaagtgcagctggaaaacggtgcctcgctgaagtccaagacggtgatcctgtcc
accggcgcacgctggcggcagatgaacgtgccgggcgagaacgagtaccgcaacaagggc
gtggcctactgcccgcactgcgacggcccgctgttcaagggcaagcgcgtggcggtgatc
ggcggcggcaactccggcgtcgaagcggccatcgacctggccggcattgtcagccacgtc
accgtgttcgagttcgacagcaagctgcgtgccgaccaggtgctgcaggccaagctcaac
agcctgcccaacgtgaaggtggtgctcaacgcacagaccaccgaagtgctgggcgacggc
cagagggtcaatggcctggtctataccgaccgcgtcggtggcgattcgcaccgcgtcgag
ctggaaggcatcttcgtgcagatcggcctgctgccgaacaccgagtggctgcgtggcacg
gtggagctcagcgatcgcggtgagatcatcatcgatgaccgcggccagaccaatgtgccg
ggcgtgtttgccgccggtgactgcaccacggtgccgtacaagcagatcgtcatcgccatg
ggcgccggttctaccgccgcactcagtgccttcgatcatctgatccgtacaccggtgctg
cagcctgcgacggcagtggaagaaaccgcctga

DBGET integrated database retrieval system