KEGG   Stenotrophomonas sp. KCTC 12332: AXG53_17780Help
Entry
AXG53_17780       CDS       T04408                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
stek  Stenotrophomonas sp. KCTC 12332
Pathway
stek00010  Glycolysis / Gluconeogenesis
stek00620  Pyruvate metabolism
stek01100  Metabolic pathways
stek01110  Biosynthesis of secondary metabolites
stek01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:stek00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AXG53_17780
   00620 Pyruvate metabolism
    AXG53_17780
Enzymes [BR:stek01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     AXG53_17780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: AMJ58274
UniProt: A0A126NN61
LinkDB All DBs
Position
4159808..4161337
Genome map
AA seq 509 aa AA seqDB search
MNAVLSAKPHATDPQSLFKSRYGNYIGGQWVAPRSGQYFDNLTPITGKMFTQVARSNAED
VELALDAAHAAKNAWGKRSTTERANILNRIADRIEENLELIAHAETWDNGKPIRETLNAD
VPLMADHFRYFAGALRAQEGSLSQIDNDTVAYHFHEPLGVVGQIIPWNFPLLMAAWKLAP
ALAAGNCVVLKPAEQTPASILVLMEVIGDLLPPGVLNIVNGFGLEAGKPLASSPRISKIA
FTGETSTGRLIMQYASQNLIPVTLELGGKSPNIFFADVMAEDDDFLDKAVEGFVMFAFNQ
GEVCTCPSRVLIQESIYEKFMERALARVAAIKQGNPLDPNTMVGAQASREQLKKILAYIE
IGRAEGAEVLIGGRQNQLDGDLADGFYVKPTVFKGHNKMRVFQEEIFGPVVSVTTFKTEE
EALEIANDTLYGLGAGLWSRDASRLYRMGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGIG
RENHKMMLDHYQQTKNLLVSYSPKKLGFF
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcagtcctgtccgccaaaccgcacgccaccgatccgcaatcgctgttcaaatcc
cgctatggcaactacatcggcggccaatgggtggccccgcgcagtggccagtatttcgac
aacctcaccccgatcaccggcaagatgttcacccaggtggcgcgttccaacgccgaggac
gtggagctggcgctggatgccgcgcacgccgccaagaacgcctggggcaagcgctccacc
accgagcgcgccaacatcctcaaccgcattgccgaccgcatagaggaaaatctcgaactg
atcgcccatgccgaaacctgggacaacggcaagccgatccgcgagacgctcaacgctgac
gtaccgttgatggccgaccacttccgctatttcgccggtgccctgcgcgcgcaggaaggc
agcctgtcgcagatcgacaacgacaccgtggcctatcacttccacgagccgctgggcgtg
gtcgggcagatcatcccgtggaacttcccgctgctgatggcggcatggaagctggcgccg
gcactggccgctggcaactgcgtggtgctgaagccagccgagcagacgccggcctcgatc
ctggtgctgatggaagtaattggcgacctgctgccgccgggcgtgctcaacatcgtcaac
ggcttcggcctggaagccggcaagccgctggccagcagcccgcgtatttccaagatcgcc
ttcaccggcgaaaccagcactggccggctgatcatgcagtacgccagccagaacctgatc
ccggtgacgctggagctgggcggcaaatcgccgaacatcttcttcgccgacgtgatggcc
gaggacgatgatttcctcgacaaggcggtggaaggtttcgtgatgttcgccttcaaccag
ggcgaggtctgcacctgcccgtcgcgcgtgttgatccaggaatcgatctacgaaaagttc
atggagcgtgccctggcgcgggtggcggcgatcaagcagggcaatccgctggaccccaac
accatggtcggcgcgcaggcctcgcgggagcagctgaagaagatcctggcctatatcgaa
ataggcagggccgagggcgccgaggtgctgatcggcggcagacagaaccagctcgatggc
gacctggccgatggcttctacgtcaagccgacggtgttcaagggccacaacaagatgcgt
gtgttccaggaggaaatcttcgggccggtggtgtcggtgaccaccttcaagaccgaagaa
gaagcgctggaaatcgccaatgacacgctctacggcctcggcgccgggctgtggagccgc
gatgcttcacgcctgtaccgcatgggccgtgcgatacaggccgggcgggtgtggaccaac
tgttatcacgcctatccggcccatgccgcattcggcggctacaagcagtcgggcatcggc
cgtgagaaccacaagatgatgctcgaccactaccagcagaccaagaacctgctggtcagc
tattcgccgaaaaagctcggctttttctga

DBGET integrated database retrieval system