KEGG   Stenotrophomonas sp. MYb57: CLM74_00140Help
Entry
CLM74_00140       CDS       T05384                                 

Definition
(GenBank) alcohol dehydrogenase AdhP
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
stem  Stenotrophomonas sp. MYb57
Pathway
stem00010  Glycolysis / Gluconeogenesis
stem00071  Fatty acid degradation
stem00350  Tyrosine metabolism
stem00625  Chloroalkane and chloroalkene degradation
stem00626  Naphthalene degradation
stem01100  Metabolic pathways
stem01110  Biosynthesis of secondary metabolites
stem01120  Microbial metabolism in diverse environments
stem01130  Biosynthesis of antibiotics
stem01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:stem00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLM74_00140
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CLM74_00140
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    CLM74_00140
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CLM74_00140
   00626 Naphthalene degradation
    CLM74_00140
Enzymes [BR:stem01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CLM74_00140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C TrkA_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AVJ31301
LinkDB All DBs
Position
complement(29800..30828)
Genome map
AA seq 342 aa AA seqDB search
MNRTMKAAVVREFGKPLVIEEVVVPRPGAGEVLVKIEACGVCHTDLHAAEGDWPVKPNPP
FIPGHEGVGHVVAVGGGVGHIKEGDRVGIPWLYSACGHCEHCLGGWETLCETQRNTGYSV
NGGFAEYALADANYVGLLPKEVGFVEIAPVLCAGVTVYKGLKVTDTKPGDWVAISGIGGL
GHMAVQYARAMGLNVAAVDVDDAKLALARRLGAQVTVNARTTDPAAFLKKEIGGAHGALV
TAVSPKAFEQALGMVRRGGTVSLNGLPPGNFPLDIFGMVLNGVTVRGSIVGTRLDLQESL
QFAAEGKVAATVSTDRLENVNEVFARMHAGTIEGRVVIDFAA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaaccatgaaggccgccgtcgtccgtgagttcggcaagccgctggtcatcgag
gaagtcgtggtaccgcgcccgggggcgggcgaggtgctggtcaagatcgaggcctgcggc
gtctgccacaccgacctgcacgccgccgagggcgactggccggtgaaaccgaacccgccg
ttcatccccggccacgagggcgtggggcacgtcgtggccgtgggaggcggggtagggcac
atcaaggaaggtgacagggtcggcatcccctggttgtactcggcgtgtggccattgcgaa
cactgcctgggtggctgggaaacgctgtgcgaaacgcagcgcaataccggctactcggtc
aacggcggcttcgccgagtacgcattggccgatgccaactatgtcggcctgcttccgaag
gaagtgggctttgtggagatcgcaccggtgctgtgcgccggcgtcaccgtgtacaagggc
ctgaaggtcaccgacaccaagcccggtgattgggtggccatttccggtatcggcggcctc
ggccacatggccgtgcagtatgcccgcgcgatgggcctgaacgtggcagcggtggatgtg
gacgacgccaagctggccctggccaggcgcctgggcgcacaggtcaccgtcaacgcgcgc
accaccgatccggccgcgttcctgaagaaggagatcggtggcgcgcatggtgcgctggtc
accgcggtttcgcccaaggccttcgaacaggcgctgggcatggtgcgtcgcggcggcacg
gtctcgctcaacggcctgccaccgggcaacttcccactggacatcttcggcatggtgctc
aacggcgtcaccgtacgcggttcgatcgtcggcacccgcctggacctgcaggaatcgctg
cagttcgccgccgaaggcaaggttgccgccacggtcagcaccgaccgcctggagaacgtc
aacgaggtgttcgcgcgcatgcacgccggcaccatcgaaggccgcgtggtgatcgacttc
gctgcctga

DBGET integrated database retrieval system