KEGG   Stenotrophomonas sp. MYb57: CLM74_00145Help
Entry
CLM74_00145       CDS       T05384                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
stem  Stenotrophomonas sp. MYb57
Pathway
stem00010  Glycolysis / Gluconeogenesis
stem00620  Pyruvate metabolism
stem01100  Metabolic pathways
stem01110  Biosynthesis of secondary metabolites
stem01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:stem00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLM74_00145
   00620 Pyruvate metabolism
    CLM74_00145
Enzymes [BR:stem01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     CLM74_00145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487 OmdA
Motif
Other DBs
NCBI-ProteinID: AVJ31302
LinkDB All DBs
Position
complement(30903..32432)
Genome map
AA seq 509 aa AA seqDB search
MNAVPSTRPHATDPRSLFKPRYGNYIGGEWIAPRSGQYFDNISPVNGQVFTEVARSNAED
IDAALDAAHAAKDAWGRTSAAHRALLLNRIADRIEQNLELLAHAETWDNGKPIRETLNAD
VPLMADHFRYFAGCLRAQEGSLSQIDDDTVAYHFHEPLGVVGQIIPWNFPLLMAAWKLAP
ALAAGNCVVLKPAEQTPASILVLMEVIGDLLPPGVLNVVNGFGLEAGKPLASSPRIAKIA
FTGETSTGRLIMQYASQNLIPVTLELGGKSPNLFFADVMAEDDDFLDKAVEGFVMFAFNQ
GEVCTCPSRALVQESIYERFMERALERVAAIRQGNPLDPNTMVGAQASGEQLEKILSYIA
IGREEGAEVLIGGDKAALGGDLAGGFYVQPTVFKGHNGMRVFQEEIFGPVVSVTTFRTEE
EALQIANDTLYGLGAGVWSRDAARLYRVGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGIG
RENHRMMLDHYQQTKNLLVSYAPKKLGFF
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccgtaccgtccacccgcccgcatgccacagatccgcgctccctgttcaagccg
cgctatggcaattacatcggtggcgaatggatcgccccgcgcagcggccagtacttcgac
aacatctcgccggtgaacggccaggtgttcactgaagttgcccgctccaacgccgaggac
atcgacgccgcactcgatgccgcgcacgccgcaaaggacgcctggggccgcacatcggcc
gcccaccgtgcgctgctgctcaaccgcatcgccgatcgcatcgaacagaacctggaactg
ctggcccacgccgagacctgggacaacggcaagccgatccgcgagacactcaacgccgac
gtgccgttgatggccgaccacttccgctacttcgccggttgcctgcgtgcgcaggagggc
agcctgtcgcagatcgacgacgacaccgtggcttaccatttccacgaaccgctgggcgtg
gtcgggcagatcatcccgtggaacttcccgctgctgatggcggcctggaagctggcgccg
gcgctggccgccggcaactgcgtggtgctcaagcctgccgagcagaccccggcgtcgatc
ctggtgctgatggaggtgatcggcgacctgctgccgccgggcgtgctcaacgtggtcaac
ggcttcggcctggaggcgggcaagccgctggccagcagcccgcgcatcgccaagatcgcc
ttcaccggcgagacctccaccggccgcctgatcatgcagtacgccagccagaacctgatt
ccggtgacgcttgagctgggcggcaaatcgccgaacctgttcttcgccgacgtgatggcc
gaggacgatgatttcctcgacaaggcggtggaaggtttcgtcatgttcgccttcaaccag
ggcgaggtctgcacctgcccgtcgcgcgcactggtgcaggaatcgatctacgaacgcttc
atggagcgtgcgctcgaacgcgtggcggcgatccgccagggcaatccgctggacccgaac
accatggtgggtgcgcaggcatcgggcgaacagctggagaagatcctgtcctacatcgcc
atcggccgcgaggaaggcgccgaggtgctgattggtggcgacaaggccgcgctcggtggc
gacctggccggcggcttctatgtgcagcccaccgtgttcaagggccacaacggcatgcgc
gtgttccaggaggagatcttcgggccggtggtgtcggtgaccacgttcaggaccgaagaa
gaagcgctgcagatcgccaacgacacgctgtacgggctgggtgccggcgtctggagccgc
gatgccgcgcgactgtaccgggtgggccgcgcaatccaggccgggcgggtatggaccaac
tgctatcacgcctacccggcgcacgccgcgttcggcggctacaagcagtcgggcatcggc
cgcgagaaccaccggatgatgctcgaccactaccagcagaccaagaacctgctggtcagc
tacgcaccgaagaagctcggcttcttctga

DBGET integrated database retrieval system