KEGG   Stenotrophomonas sp. MYb57: CLM74_00665Help
Entry
CLM74_00665       CDS       T05384                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
stem  Stenotrophomonas sp. MYb57
Brite
Enzymes [BR:stem01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CLM74_00665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu Glyco_hydro_81 LPAM_1 CHRD
Motif
Other DBs
NCBI-ProteinID: AVJ31395
LinkDB All DBs
Position
162635..163267
Genome map
AA seq 210 aa AA seqDB search
MRLIHTSLFAAIAALGLAACNQQPAAPAAEAPATTPAEGSAAPADPATAPATAAAPAADA
SATAELAPTQGNETKGSITFKLVDGKVHASGQISGLKPGSEHGFHIHEKGDCSAPDGMSA
GGHFNPGKQDHGNVATDPHHGGDMPNIKADDKGVATIDGPVSSNVNIGKGDDFDIIGRGL
IVHADADDYKTQPTGNAGARLACAVISKAP
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctgatccacacttcgctgttcgcggccatcgctgcactgggccttgccgcctgc
aaccagcaaccggcagcaccggcagccgaagccccggccaccaccccggccgaaggttcg
gcagcaccggccgatccggccactgcaccggctaccgcagcggccccggcagccgatgcc
tcggccactgccgaactggcaccgacccagggcaatgaaaccaagggctcgatcaccttc
aagctggtcgacggcaaggtgcacgcatccggccagatcagtggcctgaagccgggcagc
gagcacggcttccatatccacgagaagggtgactgcagcgcgccggacggcatgagcgcc
ggcggccacttcaatccgggcaagcaggaccacggcaacgtggccactgatccgcaccac
ggtggcgacatgcccaacatcaaggccgacgacaagggcgtagccaccattgatggtccg
gtgtcgagcaacgtcaacatcggcaagggtgatgatttcgacatcatcggccgtggcctg
atcgtccacgccgacgcggacgactacaagacccagccgaccggcaacgccggtgcgcga
ctggcgtgcgcggtgatcagcaaggctccgtaa

DBGET integrated database retrieval system