KEGG   Stenotrophomonas sp. MYb57: CLM74_02455Help
Entry
CLM74_02455       CDS       T05384                                 

Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabA
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
stem  Stenotrophomonas sp. MYb57
Pathway
stem00061  Fatty acid biosynthesis
stem01100  Metabolic pathways
stem01212  Fatty acid metabolism
Module
stem_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:stem00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CLM74_02455
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:stem01004]
    CLM74_02455
Enzymes [BR:stem01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     CLM74_02455
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     CLM74_02455
Lipid biosynthesis proteins [BR:stem01004]
 Fatty acid synthase
  Component type
   CLM74_02455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: AVJ31717
LinkDB All DBs
Position
complement(535167..535682)
Genome map
AA seq 171 aa AA seqDB search
MTRLHAFNRDQLLASARGELFGAAAGRLPNDPMLMFDRITEIREDGGPHGKGMVRAELDI
RPDLWFFGCHFIGDPVMPGCLGLDAMWQLTGFFLTWLGAPGKGRALGCGEVKFTGQVLPD
AKLVRYEIDISRVINRKLVMAQSDARMYVDDREIYNARDLRVGLFTETGSF
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgactcgtctccacgcgttcaaccgcgaccagctgctggccagcgcacgcggtgaactg
ttcggcgctgccgccggccggttgcccaacgacccgatgctgatgttcgaccgcatcacc
gaaatccgcgaggacggcggaccgcatggcaagggcatggtacgcgccgaactggatatc
cgcccggacctgtggttcttcggctgccacttcatcggcgacccggtgatgcccggctgc
ctgggcctggatgccatgtggcagctgaccggcttcttcctgacctggctgggtgccccc
ggcaagggccgcgccctgggctgcggcgaagtgaagttcaccggccaggtgctgcctgat
gccaagctggtgcgctacgagatcgacatcagccgcgtcatcaaccgcaagctggtgatg
gcccagtccgacgcacgcatgtacgtggacgaccgcgagatctacaacgcccgcgacctg
cgcgtgggcctgttcaccgaaaccgggagcttctga

DBGET integrated database retrieval system