KEGG   Stenotrophomonas sp. MYb57: CLM74_09110Help
Entry
CLM74_09110       CDS       T05384                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
stem  Stenotrophomonas sp. MYb57
Pathway
stem00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:stem00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CLM74_09110
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:stem02000]
    CLM74_09110
Enzymes [BR:stem01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CLM74_09110
Transporters [BR:stem02000]
 Other Transporters
  Pores ion channels [TC:1]
   CLM74_09110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: AVJ32920
LinkDB All DBs
Position
1964698..1965387
Genome map
AA seq 229 aa AA seqDB search
MRIVHHLENSRSLRVLWMLEELGLDYELRRYPRDPKTLLAPPELRQVHPLGKAPVLQDGD
LILAESGAILDYLVDRYDVHRQLSPSPVPAEGKERIDYRYWLHYAEGSAMPPMLLTLVIS
RIRSAPMPFFARPIARSIADKAERGFIGPQRRLHLDWMERRLAESPWFAGERFTAADIQM
SFPIQAAAARGGGLDDKPALRGFLKRIGERPAYRRAEAHGGALQALRGD
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcgtccatcatctggaaaattcccgttcgcttcgcgtgctgtggatgctggaa
gagctggggctggactacgaactgcgccgctacccgcgcgacccgaagaccctgctggcg
ccgccggaactgcgccaggtgcatccgctgggcaaggcgccggtgctgcaggatggcgac
ctcatcctggccgaatccggcgccatcctcgactacctggttgaccgctacgacgtgcat
cgccagctgtcgccgtcgccggtaccggccgaaggcaaagagcgcatcgattaccgctac
tggctgcactatgccgaaggttcggccatgccgccgatgctgctgaccctggtgatcagc
cgcatccgcagcgcgccgatgccgttcttcgcgcggccgatcgcccgcagcatcgccgac
aaggccgagcgcggtttcatcggcccgcagcgacgcctgcatctggactggatggaacgg
cgcctggccgaaagcccgtggtttgcaggcgaacgcttcaccgctgcggacatccagatg
agcttcccgatccaggcggcggccgcacgcggcggcgggctggacgacaagccggcgttg
cgtggcttcctcaagcgcatcggcgagcgtccggcctaccggcgcgccgaggcgcacggc
ggggcattgcaggccttgcgcggcgattga

DBGET integrated database retrieval system