Stenotrophomonas sp. MYb57: CLM74_17530 Help Entry CLM74_17530       CDS       T05384                                  Name (GenBank) acetolactate synthase   KO K11258   acetolactate synthase II small subunit [EC:2.2.1.6] Organism stem  Stenotrophomonas sp. MYb57 Pathway stem00290   Valine, leucine and isoleucine biosynthesis stem00650   Butanoate metabolism stem00660   C5-Branched dibasic acid metabolism stem00770   Pantothenate and CoA biosynthesis stem01100   Metabolic pathways stem01110   Biosynthesis of secondary metabolites stem01210   2-Oxocarboxylic acid metabolism stem01230   Biosynthesis of amino acids Module stem_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine stem_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:stem00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     CLM74_17530    00660 C5-Branched dibasic acid metabolism     CLM74_17530   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     CLM74_17530   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     CLM74_17530 Enzymes [BR:stem01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      CLM74_17530 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACT_5 GKAP Motif Other DBs NCBI-ProteinID:  AVJ34454 LinkDB All DBs Position 3851805..3852056 Genome browser AA seq 83 aa AA seqDB search MQYRLDLVLQPAEGALLRVIGMAERRGFAPRAITGAPVAADDGRWHLQLVVDSQRPPETL CRQMEKIYDCVSVQMTALEGASA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgcaataccggcttgacctggtgctgcaaccggccgagggcgcgctgctgcgcgtgatc ggcatggccgaacgccgcggtttcgcgccgcgcgcgatcaccggtgcgccggtggccgcc gatgatggccgttggcacctgcaactggtggtggacagccagcgcccgccggaaacgctg tgccggcagatggaaaagatctacgactgcgtttcggtgcagatgaccgcactggaagga gcatccgcatga

DBGET integrated database retrieval system