KEGG   Stenotrophomonas sp. WZN-1: CCR98_00675Help
Entry
CCR98_00675       CDS       T04963                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
sten  Stenotrophomonas sp. WZN-1
Brite
Enzymes [BR:sten01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CCR98_00675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu Glyco_hydro_81 LPAM_2 CHRD
Motif
Other DBs
NCBI-ProteinID: ARZ72763
UniProt: A0A1Z2LEM5
LinkDB All DBs
Position
157127..157753
Genome map
AA seq 208 aa AA seqDB search
MRLIHTSLFAAITALGLAACGQQPAAPQTETPPAAPAEGATTEPAATPEPATAPAADASA
TAELAPTQGNETKGSVTFKVVDGKVHVTGQVTGLKPGSEHGFHIHEKGDCSAPDGMSAGG
HFNPGKQDHGNVATDPHHGGDMPNIKADDKGVATIDGPVSSNVNIGKGDDFDIIGRGLIV
HADADDYKTQPTGNAGARLACAVIQKAP
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctgatccacacttcgttgtttgcggccatcaccgcgctgggcctggcggcctgc
ggccaacagccggccgctccgcagactgaaaccccgccggccgccccggccgagggtgca
accaccgaaccggcggcaacgccggaaccggccaccgcaccggctgccgatgcttcggca
acggccgagctggcaccgacccagggcaacgaaaccaagggcagcgtcaccttcaaggtg
gtcgatggcaaggtccacgtaaccggccaggtcacgggcctgaagccgggcagcgagcac
ggcttccacatccacgaaaagggcgactgcagcgcgccggacggcatgagcgccggcggc
cacttcaacccgggcaagcaggatcacggcaatgtggccaccgatccgcaccacggtggc
gacatgcccaacatcaaggccgacgacaagggcgtagccaccatcgatggcccggtgtcg
agcaacgtcaacatcggcaagggtgatgacttcgacatcatcggccgcggcctgatcgtc
cacgccgacgcggacgactacaagacccagccgaccggcaacgccggcgcgcgcctggcg
tgtgcggtgatccagaaggccccgtaa

DBGET integrated database retrieval system