KEGG   Stenotrophomonas sp. WZN-1: CCR98_03765Help
Entry
CCR98_03765       CDS       T04963                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sten  Stenotrophomonas sp. WZN-1
Brite
KEGG Orthology (KO) [BR:sten00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CCR98_03765
Enzymes [BR:sten01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CCR98_03765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored DAO Glutaredoxin AlaDh_PNT_C FAD_binding_3 K_oxygenase Thi4 NAD_binding_8 Thioredoxin_4 FMO-like dsrm
Motif
Other DBs
NCBI-ProteinID: ARZ73335
UniProt: A0A1Z2LGE5
LinkDB All DBs
Position
complement(826605..828197)
Genome map
AA seq 530 aa AA seqDB search
MLDANLQSQLKTYLERVTRPIQITAHADDGAKSQEMLELLQTLDSLSDKITLQVLRDGQG
RVPSFDLGTPGQDIHLTFAGLPMGHEFTSLVLALLQVGGHPSKATAELIEQVQNLEGDYK
FETYFSLSCQNCPDVVQALNLAAVLNPRIQHVAIDGALFQEEVEQREIMSVPTVYLNGEV
FDQGRMTLEQIVAKLDTNASKRDAEKIAAKDAFDVLVVGGGPAGAAAAIYAARKGIRTGI
AAERFGGQVLDTMAIENFISVKETEGPKLATALEQHVREYEVDIMNLQRASALVPAGEDG
LVQVQLENGAVLKSRSVILSTGARWRQMNVPGEDQYRNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVSHVTLLEFDSSLRADEVLQKKLRSLANVTVLTSAQTTEVLGDG
SRVTGLVYKDRVGGDAHRVELEGIFVQIGLLPNTEWLKDVVALSPRGEVVIDDRGQTNLP
GVFAAGDCTTVPYKQIIIAMGAGSTAALSAFDHLIRSSVSNSSGAVAEAA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccaacctgcagtcgcagctgaagacctatctggagcgcgtgacccgcccg
atccagatcaccgcgcacgccgatgacggcgccaagtcgcaggaaatgctggaactgctg
cagaccctggacagcctgtcggacaagatcacgctgcaggtcctgcgcgatggccagggc
cgcgtgccgtccttcgacctgggcacgccgggccaggacatccacctgaccttcgccggc
ctgccgatgggccacgagttcacttcgctggtgctcgcgctgctgcaggtcggcggccac
ccgtccaaggccaccgccgagctgatcgagcaggtgcagaacctggagggtgactacaag
ttcgaaacctacttctcgctgtcctgccagaactgcccggacgtggtgcaggcgctgaac
ctcgccgcggtgctcaacccgcgcatccagcacgtggccatcgacggcgccctgttccag
gaggaagtcgagcagcgcgagatcatgtcggtgccgaccgtgtacctcaacggtgaagtg
ttcgaccaaggccgcatgaccctggagcagatcgtggccaagctggacaccaatgccagc
aagcgcgatgccgagaagatcgccgccaaggacgccttcgacgtgctggtggtcggcggt
ggcccggctggcgcggcagcggcgatctatgccgcgcgcaagggcatccgcaccggcatc
gccgccgagcgtttcggtggccaggtgctggacacgatggcgatcgagaacttcatttca
gtgaaggagaccgaaggcccgaagctggccaccgcgctggaacagcacgtgcgcgagtac
gaggtggacatcatgaacctgcagcgcgccagcgcgctggtgccggccggtgaagacggc
ctggtgcaggtgcagctggaaaacggcgcggtgctgaagtcgcgctcggtgatcctgtcc
accggcgcgcgctggcggcagatgaacgtgcccggcgaagaccagtaccgcaacaagggc
gtggcctattgcccgcactgcgatggcccgttgttcaagggcaagcgtgtggcggtgatc
ggcggcggcaactccggcgtggaggcggccatcgatctggctggcatcgtgtcgcatgta
accctgctggaattcgattccagcctgcgcgccgatgaagtgctgcagaaaaagctgcgc
agcctggccaacgtcaccgtgctgaccagcgcacagaccaccgaggtgctgggcgacggc
agccgcgtcaccggcctggtctacaaggaccgcgtcggcggcgatgcccaccgcgtcgag
ctggaaggcatcttcgtgcagatcggcctgctgcccaacaccgagtggctgaaggatgtg
gtggcgctttcgccgcgtggcgaggtggtcatcgatgaccgcggccagaccaacctgccg
ggtgtattcgctgctggcgattgcacgacggtgccctacaagcagatcatcatcgccatg
ggcgccggctcgaccgccgcactgagcgcgttcgaccacctgatccgctcgtcggtaagc
aacagcagcggtgccgttgctgaagcggcctga

DBGET integrated database retrieval system