KEGG   Stenotrophomonas sp. WZN-1: CCR98_07195Help
Entry
CCR98_07195       CDS       T04963                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
sten  Stenotrophomonas sp. WZN-1
Pathway
sten00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:sten00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CCR98_07195
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sten02000]
    CCR98_07195
Enzymes [BR:sten01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CCR98_07195
Transporters [BR:sten02000]
 Other Transporters
  Pores ion channels [TC:1]
   CCR98_07195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C_2 GST_N_2 GST_C GST_C_3
Motif
Other DBs
NCBI-ProteinID: ARZ73967
UniProt: A0A1Z2LI19
LinkDB All DBs
Position
complement(1560094..1560714)
Genome map
AA seq 206 aa AA seqDB search
MTSRQITLYHAARSRSSGAVALLEALGADYRMQVLDLKAGANLAPAYLAINPMGKVPAIV
HNGALVTEQVAIYLYLADLYPEAGLAPPIGDALRGPYLRWMAFYGACFEPAMIDKAMHRE
PPPRLMSPYNDAETVLQVVEAQLAQGPYLLGETMSAADVLWGNALAWTTAFGLVQPAPAT
ADYIARMSAMTAFDRSRQIDAELAAA
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgacctcacgccagatcaccctgtatcacgctgcccgttcgcgctcgagcggcgcggtg
gccctgctcgaggcgctgggtgcggactaccgcatgcaggtgctggacctgaaggccggc
gccaacctggccccggcctacctggccatcaacccgatgggcaaggtgccggccatcgtc
cacaacggcgcgctggtgaccgagcaggtagcgatctacctgtacctggccgacctgtac
ccggaagccgggctggcgccgccgatcggcgacgccctgcgcggcccctacctgcgctgg
atggccttctacggtgcctgtttcgagccggcgatgatcgacaaggccatgcaccgcgag
ccaccgccgcgcctgatgtcgccttacaacgatgcggagaccgtgctgcaggtggtcgag
gcccagctggcgcagggcccctacctgctcggcgagacgatgagcgccgccgacgtgctg
tggggcaatgcgctggcctggaccacggccttcggcttggtgcagcctgcgccggccacg
gctgattacattgcacggatgagcgcgatgaccgccttcgaccgttcgcggcagatcgat
gcggagctggcggcggcgtaa

DBGET integrated database retrieval system