KEGG   Stenotrophomonas sp. WZN-1: CCR98_18745Help
Entry
CCR98_18745       CDS       T04963                                 

Definition
(GenBank) peptidase S11
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
sten  Stenotrophomonas sp. WZN-1
Pathway
sten00550  Peptidoglycan biosynthesis
sten01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sten00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CCR98_18745
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sten01002]
    CCR98_18745
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sten01011]
    CCR98_18745
Enzymes [BR:sten01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CCR98_18745
Peptidases and inhibitors [BR:sten01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   CCR98_18745
Peptidoglycan biosynthesis and degradation proteins [BR:sten01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   CCR98_18745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 Beta-lactamase2 Peptidase_S13 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: ARZ76120
UniProt: A0A1Z2LP63
LinkDB All DBs
Position
4015912..4016706
Genome map
AA seq 264 aa AA seqDB search
MPSPAPARAPLSSITIEASTFAVIHQHNAGIARQPASLTKLMTAYAAYECVEENGRAWDE
AVIIAAEDVHAVAGDETRMGLLPGERVSLARLLEGLMIVSGNDAALAIARHLDGSQPAFL
DRMNRHAHQLGLRSTWFASVSGITTPHHASSARDMAVLAACLLNDHPQILAITAQRAFAH
GSFSRSNQNALLGENGVDGLKTGYTQAAGFCLAATACRSVPGRDQPVRLITVVLGSGSRD
ARDALVRERLAAGFAALAGNTADA
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgccgtctcctgctcctgcgcgcgcgccgctgtcctccatcaccatcgaagccagcacc
ttcgcggtgatccaccagcacaacgcgggcatcgcgcggcaaccggcctcgctgaccaag
ctgatgaccgcctacgccgcttacgaatgtgtcgaagagaacggaagggcgtgggacgaa
gcggtcatcatcgccgccgaggatgtgcatgcggtggccggcgatgaaacgcgcatgggc
ctgctgcccggcgaaagggtcagcctggcacgcctgctggaagggttgatgatcgtctcc
ggcaatgatgcggcgctggccatcgcgcgccatctggacggatcacagcctgcgttcctg
gaccgcatgaaccggcacgcgcaccagcttggcctgcgcagcacgtggttcgccagcgtg
tccggcatcaccaccccgcaccatgcctccagcgcgcgcgacatggcggtactcgccgcc
tgcctgctgaacgaccatccgcagatcctggcgatcaccgcacagcgcgcgttcgcgcat
ggcagcttcagccgcagcaaccagaacgccctgcttggcgaaaacggcgtggatggattg
aagaccggctacacccaggcagcaggcttctgcctggccgccaccgcatgccggtcagtg
cccgggcgtgatcagccggtacgcctgatcaccgtggtcctgggttctggaagccgcgac
gcacgcgatgcccttgtgcgcgagcgtctggccgccgggttcgcggcgctggccggcaac
accgccgacgcctga

DBGET integrated database retrieval system