KEGG   Sphingopyxis terrae: AOA14_01375Help
Entry
AOA14_01375       CDS       T04307                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ster  Sphingopyxis terrae
Pathway
ster00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ster00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AOA14_01375
Enzymes [BR:ster01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AOA14_01375
Transporters [BR:ster02000]
 Other Transporters
  Pores ion channels [TC:1]
   AOA14_01375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C GST_C_3 Glutaredoxin RNR_N
Motif
Other DBs
NCBI-ProteinID: AMU93250
UniProt: A0A142VTX2
LinkDB All DBs
Position
287998..288669
Genome map
AA seq 223 aa AA seqDB search
MWQLYQFPLCPFSRKVRLLLGEKGVGYELVRESPWERRDEFVDLNPAGRTPVMVDEGRGQ
VLIDSNAIAEYFEETVEGKAMINGTAANRAEIRRLVAWFDQEFYFEVTGPLLFERMQKRI
VHRQPPDGGALREAMKAANQHLDYIDYLIDHRTWLAGATMSLADLAAAAHISVADYLGGI
DWTGHDQTKGWYSGLKSRPSFRPLLAERMEIVTPPKYYEDVDF
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgtggcaactctatcaattccctctctgtcccttctcgcgcaaggtccggctgctgctc
ggcgaaaagggcgttggttatgaattggtgcgcgaatcaccgtgggaacgccgtgacgaa
ttcgtcgacctgaaccccgccgggcgtaccccggtgatggtggacgaggggcgcggacaa
gtgctcatcgacagcaacgccatcgccgaatatttcgaggagacggtcgagggcaaggca
atgatcaacggcaccgccgccaatcgcgccgagatccgccgcctggtcgcctggttcgac
caggaattctatttcgaagtcaccggcccgctgcttttcgaacggatgcagaagcgcatc
gtccaccgccagccacccgacggcggcgcgctgcgcgaagcgatgaaggcggcgaaccag
cacctcgactatatcgactatctcatcgaccatcgcacctggcttgccggtgcgacgatg
agcctcgccgatctcgccgccgcggcgcacatctcggtcgccgactatctgggcggcatc
gactggaccgggcacgatcagactaagggctggtattcaggcctcaagtcgcgcccgagt
ttccggccgctgctggccgaacggatggaaatcgtgacgccgcccaaatattatgaagac
gtcgatttctag

DBGET integrated database retrieval system