KEGG   Sphingopyxis terrae: AOA14_03525Help
Entry
AOA14_03525       CDS       T04307                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ster  Sphingopyxis terrae
Brite
KEGG Orthology (KO) [BR:ster00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AOA14_03525
Enzymes [BR:ster01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AOA14_03525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_oxidored Thioredoxin_3 FAD_binding_2 HI0933_like FAD_binding_3 AlaDh_PNT_C DAO NAD_binding_8 Thi4 NAD_binding_7 K_oxygenase Glutaredoxin FMO-like
Motif
Other DBs
NCBI-ProteinID: AMU93676
UniProt: A0A142VV59
LinkDB All DBs
Position
complement(723829..725412)
Genome map
AA seq 527 aa AA seqDB search
MLDANMKQQLQGLLTNLREPIELLSSLGDDAKSAELAALLNDIAALSDKVSVTRTDDDAR
RPSFLIRRASDARVAVRFAGIPLGHEFTSLVLALLQVGGHPPKVSAEVLGQVAELDGDFH
FETYFSLSCQNCPDIVQALNLMSVVNPRITHTAIDGGLFQAEVEERKIMAVPTIFLNGQN
FGQGRMELEQILAKLDTGAEAKAAEKIGAKEAFDVLVVGGGPAGAAAAIYAARKGIRTGI
ATERFGGQVLDTMAIENFISVQHTEGPKLVAQLESHVKDYDVDIMNLQRAEKLIPAKAEG
GLHEIVLANAASLKARTVILSTGARWRQLGVPGEDAYRNKGVAYCPHCDGPLYQGKRVAV
IGGGNSGVEAAIDLAGIVAHVTLIEYDSQLRADAVLQRKLASLPNVRIITSALTTEVLGD
GEKVTGLAYKDRNSDAPHQVELEGIFVQIGLVPNTEWLKDSVTLSRHGEIEVDHRGETSQ
RGIFAAGDCTTVPYKQIVIAMGEGSKAALSAFDYMIRLPADVDVEAA
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccaatatgaagcagcagcttcagggcctcctcacgaaccttcgtgaaccg
atcgaactgctctcgtcgctcggcgacgatgcgaagtcggccgagctggcggcgctcctc
aacgatatcgccgcgctgtcggacaaggtcagcgtgacgcgcaccgacgacgatgcgcgt
cggcccagcttcctgatccgccgcgcgagcgacgcccgtgtcgcggtgcgcttcgcgggc
atcccgctcggccatgaattcacctcgctcgttctcgcgctgctccaggtcggcggccac
ccgccgaaggtgagcgccgaggtgctcgggcaagtggcggagctcgatggcgacttccac
ttcgaaacctatttctcgctgtcgtgccagaattgccccgacatcgtgcaggcattgaac
ctgatgagcgtggtcaacccgcgcatcacccacaccgcgatcgacggcgggctgttccag
gccgaggtcgaggagcgcaagatcatggccgtgccgacgatcttcctgaatgggcagaat
ttcggtcagggccgcatggagctcgaacagatcctcgccaagctcgacaccggcgccgaa
gcgaaggcggcggaaaagatcggcgctaaggaggcgttcgacgtgctcgtcgtcggcggt
ggccccgcgggcgccgcggctgcgatctacgcggcgcgcaagggtatccgcaccggcatc
gccaccgaacgcttcggcggtcaggtgctcgacaccatggcaatcgagaatttcatctcg
gtccagcacaccgaagggccgaagctcgttgcgcagctcgagagccacgtcaaagattat
gacgtcgacatcatgaacctgcagcgcgccgagaaactgatcccggcgaaggccgaaggg
ggcctgcacgaaatcgtgctggcgaacgccgcgtcgctcaaggcgcgcaccgttatcctc
tcgaccggcgcgcgctggcgccagctcggcgtgccgggcgaggatgcctatcgcaacaag
ggcgtcgcctattgcccgcactgcgacggcccgctctaccagggcaagcgcgtcgcggtg
atcggcggcggcaattcgggcgtcgaggcggcgatcgatcttgccggcatcgtcgcgcac
gtcacgctgatcgaatatgacagccagctccgcgccgacgccgtcctccagcgcaagctc
gcgagcctgcccaatgtccggatcattacctcggcgctgaccaccgaagtgctcggcgac
ggcgaaaaggtgaccgggcttgcctataaggaccgcaattcggacgcgccgcaccaggtc
gaactcgaaggcatcttcgttcagatcggcctcgtgccgaacaccgaatggctcaaggac
agcgttaccctgtcgcgccacggcgaaatcgaggtcgaccatcgcggcgagacgagccag
cgcggcatcttcgccgcgggcgattgcacgaccgtgccctacaagcagatcgttatcgcg
atgggcgaaggatctaaggcggcgctgtcggccttcgattacatgatccgcctgcccgcg
gatgtggacgtcgaagcggcgtga

DBGET integrated database retrieval system