KEGG   Sphingopyxis terrae: AOA14_09895Help
Entry
AOA14_09895       CDS       T04307                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ster  Sphingopyxis terrae
Pathway
ster00620  Pyruvate metabolism
ster00680  Methane metabolism
ster01100  Metabolic pathways
ster01120  Microbial metabolism in diverse environments
ster01200  Carbon metabolism
Module
ster_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ster00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AOA14_09895
  09102 Energy metabolism
   00680 Methane metabolism
    AOA14_09895
Enzymes [BR:ster01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AOA14_09895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AMU94915
UniProt: A0A142W053
LinkDB All DBs
Position
complement(2044975..2047644)
Genome map
AA seq 889 aa AA seqDB search
MGPPIQISQNPDIRYLGRILGDVIRAYGGEKLFRQTEYIRSSSVDRHRGIAGAETIDPGL
EALSLDDTIAFVRGFMLFSMLANLAEDRQGVAAEPEATVAAALARLKQDGIDGDAVAALL
GAALVAPVLTAHPTEVRRKSMLDHKNRIAELMRLRDAGVEETAEGDVVEEAIRRQIVLLW
QTRPLRTEKLFVADEIDNALTYLRDVFVPVIPKLYARWEQELGARPASFLRVGSWIGGDR
DGNPFVTAETLHMATSRNAAAVLGHYIDAVHALGAELSVSSSLATVSEAVEALAAASGDT
APSRSDEPYRRALSGIYARLCATYAGIVGRAPPRPSALAGDAYAAPADFRRDLVTIAAGL
SASGEGQLGGIGALGRLIRAVEVFGFHLATLDMRQNSAVHERVLAELLAVAGVEGDYLSL
GEEARVELLRRELATNRPLAAPWHKWSEETAGELAIVHAAAAIRARLGVEAIVQWIISKA
ESLSDLLEVHVLAREAGLWSAEAQDNLMVVPLFETIADLDEAPGIMAAYFALPEIAPHVV
ARGHQEVMIGYSDSNKDGGYLTSTWGLYQASEALTPVFEAADTAMQLFHGRGGAVGRGGG
SAFAAIRAQPAGTVQGRIRITEQGEVIAAKYGTADSAATNLEAMVSASLLASLEPEAMSA
DDAGRFAGAMTALSNDAFAAYRGLVYDTPAFKDFFRAMTPIAEIATLKIGSRPSSRTKST
AIEDLRAIPWVFSWAQARTMLPGWYGTGEAFAAFADQALLADMAQSWPFFGALLGNMEMV
LAKSDIGIAARYAELAGDVGGHAAIFSRIRDGWHRAHDGLLTITGQSRLLENNPALEASI
RLRLPYIEPLNLLQIELMKRHRAGETDPRIAEGIQLTINAIATALRNSG
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
atgggcccaccaatccagatctcgcaaaatcccgacatccgctatctcgggcgaatcctc
ggcgacgtcattcgcgcctatggcggcgagaagctgttccggcagaccgaatatatccgg
tcgtcgagcgtcgaccggcatcgcggcatcgcgggcgccgagacgatcgatccggggctg
gaggcgctgagcctcgacgataccatcgccttcgtgcgcggcttcatgctgttttcgatg
ctcgccaatctggccgaagaccggcagggcgtcgccgccgagcccgaggcgacggtggcg
gcagcgcttgcccggctgaaacaggacggtatcgatggcgatgcggtcgcggcgctgctc
ggcgccgcgctggtcgcgccggtgctcaccgcgcacccgaccgaggtgcgccgcaagtcg
atgctcgaccacaagaaccgcatcgccgagctgatgcggctgcgcgatgccggcgtcgag
gaaaccgccgagggcgatgtcgtcgaggaagcgatccgccgccagatcgtgctgctgtgg
cagacgcggccgctgcgcaccgaaaaattgttcgttgccgacgagatcgacaatgcgctg
acctatttgcgcgacgtgttcgtgcccgtgatccccaagctttatgcgcgctgggaacag
gaacttggcgcgcgcccggcaagcttcctgcgcgtcgggagctggatcggcggcgaccgc
gacggcaatcctttcgtcaccgccgagacgctgcatatggcaacgagccgcaacgccgcc
gcggtgctcggccattatatcgacgcggtgcatgcgctcggcgccgaactgtcggtgtcg
tcttcgctcgcgacagtctccgaagcggtcgaggcactggccgcggcgagcggcgatacc
gcgccgagccgcagcgacgagccctatcgccgcgcactgtcgggcatctatgccaggttg
tgcgcaacctatgccggcatcgtcgggcgcgcgccgccgcggccgtcggcactggccggc
gacgcctatgccgctcccgccgattttcgccgcgacctcgtcaccatcgccgccggcctg
tcggcgagcggcgagggccagcttggcggcatcggcgcgctcggccggttgatccgcgcg
gtcgaggtcttcggtttccaccttgcgacgctcgacatgcggcagaacagcgcggtgcac
gaacgcgtgctcgccgagctgctcgcggtcgcgggcgtcgaaggcgattatctcagcttg
ggcgaagaggcgcgcgtcgagctgctgcgccgcgaactggcgaccaaccgcccgcttgcc
gcgccgtggcacaaatggagcgaagaaaccgccggcgaactcgcgatcgtccacgccgcc
gccgcgatccgcgccaggctgggcgtcgaggcgatcgtccagtggatcatcagcaaggcc
gaaagcctgtccgacctgctcgaagtccatgtcctcgcccgcgaagccggattgtggtcg
gccgaggcgcaggacaatctgatggtcgtgccgctgttcgaaaccatcgccgacctcgac
gaggcgccggggatcatggccgcctatttcgcgctgcccgagattgcgccgcatgtcgtc
gcgcgcggacatcaggaagtgatgatcggctattcggattcgaacaaggatggcggctat
ctgacctcaacatgggggctctaccaggcatcggaagcgttgaccccggtgttcgaggcc
gccgataccgcgatgcagctgttccacggtcgcggcggtgcggtcgggcgcggcggcggc
agcgctttcgctgcgatccgcgcgcagcccgcggggacggtgcagggccgcatccgcatc
accgaacagggtgaagtgatcgcggccaaatatggcaccgccgacagcgccgcgaccaat
ctggaggcgatggtatcggcaagcctgctcgccagcctcgagcccgaggcgatgagcgcg
gacgacgccgggcgctttgcgggtgctatgaccgcgctgtcgaacgacgccttcgccgcc
tatcgcggcctcgtttacgacacgcccgccttcaaggacttcttccgtgcaatgacgccg
atcgccgagatcgcgacgctgaagatcggatcgcggccgtcgagccgcaccaaatcgacc
gcgatcgaggacctgcgcgcgatcccctgggtgttcagctgggcgcaggcgcgcaccatg
ctgcccggctggtacggcaccggcgaggcctttgcggcgttcgcggaccaggcgctgctc
gccgatatggcgcaaagctggcccttcttcggcgcgctgctcggaaatatggaaatggta
ctggcaaaatcggacatcggcatcgccgcgcgctatgccgaactggccggggatgtgggc
gggcatgcggcgattttttcgcgcatccgcgacggctggcaccgcgcccacgacgggctt
ttgacaatcaccggccagtcgcggctgctcgagaataatccagcgctcgaggcatcgatc
cgcctgcgcctgccctatatcgagccgctcaacctgctgcagatcgaattgatgaagcgc
catcgcgcgggcgaaaccgacccccgcatcgccgagggcatccagttgaccatcaacgcg
atcgcaaccgcgctgcgcaacagcgggtag

DBGET integrated database retrieval system