KEGG   Sphingopyxis terrae: AOA14_10200Help
Entry
AOA14_10200       CDS       T04307                                 

Definition
(GenBank) succinate dehydrogenase
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
ster  Sphingopyxis terrae
Pathway
ster00020  Citrate cycle (TCA cycle)
ster00190  Oxidative phosphorylation
ster00650  Butanoate metabolism
ster01100  Metabolic pathways
ster01110  Biosynthesis of secondary metabolites
ster01120  Microbial metabolism in diverse environments
ster01130  Biosynthesis of antibiotics
ster01200  Carbon metabolism
Module
ster_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ster_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ster_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ster00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AOA14_10200
   00650 Butanoate metabolism
    AOA14_10200
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AOA14_10200
Enzymes [BR:ster01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AOA14_10200
    1.3.5.4  fumarate reductase (quinol)
     AOA14_10200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_10 Fer4_8 Fer4_9 Fer2 Fer4_7
Motif
Other DBs
NCBI-ProteinID: AMU94975
UniProt: A0A142W0B4
LinkDB All DBs
Position
2098080..2098862
Genome map
AA seq 260 aa AA seqDB search
MAEFRLPKNSRVQKGGTVHKAEGASNVKKFKVYRYNPDSGQNPHFDTFEIDTDKCGPMVL
DALIKMKSEQDSTLTFRRSCREGICGSCSMNMNGKNGLACTTAIEDLKGDIQITPLPHME
VIKDLVPDFTHFYAQYASIEPWLKTKSTTPSGKERLQSPEEREKLDGLYECILCACCSTS
CPSYWWNSDKFLGPAILLQAYRWLADSRDEYTGERLDDLEDPFRLYRCHTIMNCANACPK
GLSPARAIAEIKKLEAERQV
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggccgaatttcgtctgcccaagaacagccgcgtccagaagggcggcacggtccacaag
gccgagggcgcgagcaacgtcaaaaaattcaaggtctatcgctacaatcccgacagcggc
cagaatccgcatttcgacacgttcgagatcgacaccgacaaatgcggcccgatggtgctc
gatgccctcatcaagatgaagagcgagcaggattcgacgctgaccttccgccgttcgtgc
cgcgaaggcatttgcggcagctgttcgatgaacatgaacggcaagaacggtctcgcctgc
accaccgcgatcgaggatctgaagggcgacatccagatcacgccgctgccgcatatggag
gtcatcaaggacctcgtccccgatttcacccatttctatgcgcaatatgcctctatcgag
ccgtggctgaagaccaagtcgacgacgcccagcggcaaggagcggctccagtcgcccgag
gaacgcgagaagctcgacggcctttacgagtgcatcctgtgcgcctgctgttcgacgagc
tgccccagctattggtggaacagtgacaagttccttgggcccgcgatcctgcttcaggcc
tatcgctggctcgccgacagccgcgacgaatatactggcgaacggctcgacgatctcgaa
gatccgttccgcctctatcgctgccacacgatcatgaattgcgccaacgcgtgccccaag
ggactgagccccgcacgcgcgatcgccgagatcaagaagctcgaggccgagcggcaggtg
tga

DBGET integrated database retrieval system