KEGG   Sphingopyxis terrae: AOA14_14760Help
Entry
AOA14_14760       CDS       T04307                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ster  Sphingopyxis terrae
Pathway
ster00010  Glycolysis / Gluconeogenesis
ster00020  Citrate cycle (TCA cycle)
ster00620  Pyruvate metabolism
ster01100  Metabolic pathways
ster01110  Biosynthesis of secondary metabolites
ster01120  Microbial metabolism in diverse environments
ster01130  Biosynthesis of antibiotics
ster01200  Carbon metabolism
Module
ster_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ster00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AOA14_14760
   00020 Citrate cycle (TCA cycle)
    AOA14_14760
   00620 Pyruvate metabolism
    AOA14_14760
Enzymes [BR:ster01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AOA14_14760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 TonB_N DEC-1_N QRPTase_N RnfC_N DUF3597
Motif
Other DBs
NCBI-ProteinID: AMU95872
UniProt: A0A142W1N3
LinkDB All DBs
Position
3107276..3108556
Genome map
AA seq 426 aa AA seqDB search
MPIELKMPALSPTMEEGTLAKWLVKEGDSVQSGDLLAEIETDKATMEFEAVDEGTIAQIL
IPEGTDNVKVGTVIAVIAGEDEDAGSTKVAPTPAPAPAPAAKADPAPAPAAAPAPAPTAA
PAPAAQGERIKASPLAKRIAADKGIDLTALTGSGPGGRIVKADLEGAAASTAAPASAAAP
SPAPAAAPAPAQPFETDIPHSAEKLSNMRKTIARRLTQSKQEVPHIYLTVDVQLDKLLKL
RGELNAALEPQGVKLSVNDLLIKALAKALIQVPKCNVSFAGDQLISYERADISVAVSVPA
GLITPIIVGADDKSVSKISTEMKELAGRAKEGKLQPHEYQGGTASLSNMGMFGIKQFEAV
INPPQGMIMAIGAGEKRPYVVDDALAIATVMSATGSFDHRAIDGADGAQLMQAFKQIVEN
PLGLVA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgccgattgaactgaagatgcccgccctttcgccgacgatggaggaagggaccctcgcc
aaatggctggtgaaggagggggacagcgtccagtcaggtgaccttttggccgaaatcgaa
accgacaaggcgacgatggaattcgaagcggtcgatgaaggcacgatcgcacaaatcctg
atccccgaaggcaccgacaatgtgaaggtcggcaccgtgatcgccgttatcgccggcgag
gacgaggatgcgggcagcaccaaggttgcgcctacgcctgcacctgcaccggcgcctgcc
gccaaggccgaccccgcgcctgctcccgcggctgcacccgctccggcgccgaccgccgcc
ccggcccctgccgcgcagggcgagcggatcaaggcgagcccgctcgccaagcgcatcgcc
gccgacaagggcatcgatctcaccgcgctgaccggcagcggacccggcggccgcatcgtc
aaggccgacctcgaaggcgctgctgcgtcgaccgccgccccggcaagcgcggccgcgccc
agccccgcgcccgccgctgcgcccgcccccgcgcagccgttcgaaaccgacattccgcac
agcgcggaaaagctcagcaatatgcgcaagacgatcgcgcgccgcctgacccagtcgaag
caggaggtgccgcacatctatctgacggtcgatgtccagctcgacaaattgctcaagctg
cgcggcgaactcaacgcggcactcgagccgcagggcgtcaagctcagcgtcaacgacctg
ctgatcaaggcgctggcaaaggcgctgatccaggtgccgaaatgcaatgtcagcttcgcc
ggcgatcagctcatcagctacgaacgcgccgacatttcggtcgcggtcagcgtgccggct
ggcctgatcaccccgattatcgtcggcgccgacgacaagtcggtcagcaagatttcgacc
gagatgaaggaacttgcgggccgcgccaaggaaggcaagctccagccgcacgaatatcag
ggcggcaccgccagcctgtcgaacatgggcatgttcggcatcaagcagttcgaggcggtc
atcaacccgccgcagggcatgatcatggcgatcggcgcgggcgagaagcggccttatgtg
gtcgacgacgcgctcgccatcgcgaccgtgatgtcggccacgggcagcttcgaccaccgc
gccatcgacggcgcagacggcgcgcagttgatgcaggcgttcaagcagatcgtcgaaaac
ccgctcggactggtggcgtaa

DBGET integrated database retrieval system