KEGG   Stenotrophomonas sp. ASS1: MG068_03050Help
Entry
MG068_03050       CDS       T06051                                 

Definition
(GenBank) UDP-N-acetylmuramate--L-alanine ligase
  KO
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
stes  Stenotrophomonas sp. ASS1
Pathway
stes00471  D-Glutamine and D-glutamate metabolism
stes00550  Peptidoglycan biosynthesis
stes01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stes00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    MG068_03050
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MG068_03050
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:stes01011]
    MG068_03050
Enzymes [BR:stes01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     MG068_03050
Peptidoglycan biosynthesis and degradation proteins [BR:stes01011]
 Precursor biosynthesis
  Amino acid ligase
   MG068_03050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: QBL39553
UniProt: A0A4P6VX51
LinkDB All DBs
Position
671725..673161
Genome map
AA seq 478 aa AA seqDB search
MIRRLHDTNDLVRAFPRVHFVGIGGTGMSGIAEVMLTLGYEVSGSDNADNVATRRLASLG
ARIMRGHSAANVLGTDCVVVSSAIREDNPELMEARSQRIPIMPRAAMLAELMRFRRGIAV
AGTHGKTTTTSLTAAVLSEGGLDPTFVIGGQLLAAGANAKLGGGQWLVAEADESDGSFLR
LNPLMSIITNIDADHLENYGNDFARVQAAFAEFLQRLPFYGLAVLCIDDPEVAALAAKTP
RHVMSYGMSPQADVRAENVVQEGSRMRFTLRLPQGTSQEVVLALPGKHNVLNALAAAAVG
WQLGVAPDAIARALEGFAGVGRRFNDLGEVTTASGAKVRIIDDYGHHPSELEAVFAAARG
GWADKRLVVAFQPHRYSRTRDQFDKFAAVLSSVDALVLSEVYPAGEEPIAGADSHALARA
IRARGRSEPVVVGKAAELASVLPDVLQDGDLLLMMGAGDIGAVATHIAVEGFKGEGEA
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgatccgtcgcctgcacgacaccaacgacctggtgcgcgcgttcccgcgcgtgcatttc
gtcggcatcggcggcaccggcatgagcggtatcgccgaagtgatgctgacgctgggctat
gaggtgtccggctcggacaacgccgacaacgtggcgacccgtcgcctggccagcctgggt
gcgcgcatcatgcgcggccactccgcagccaacgtgctgggcaccgactgcgtggtggtc
tccagcgccatccgcgaagacaacccggaactgatggaagcgcgcagccagcgcattccg
atcatgccgcgtgcggcgatgctggccgagctgatgcgcttccgccgcggcatcgctgtg
gccggtacccatggcaagaccaccaccaccagcctcaccgctgcagtgctgagcgaaggc
gggctcgacccgacgttcgtgatcggtggccagctgctggctgccggcgccaacgccaag
ctgggcggtggacagtggctggtggccgaggccgacgaaagcgatggcagcttcctgcgc
ctgaacccgctgatgtcgatcatcaccaacattgacgccgatcacctggagaactacggc
aacgactttgcccgcgtgcaggcggcgttcgccgagttcctgcagcgcctgccgttctac
ggcctggcggtgctgtgcatcgacgatccagaagtcgcggctctggctgccaagaccccg
cgccacgtgatgagctacggcatgagcccgcaggccgacgtgcgcgccgagaacgtggtg
caggaaggctcgcgcatgcgcttcaccctgcgcctgccgcagggcaccagccaggaagtg
gtgctggcgctgccgggcaagcacaacgtactcaacgcgctggccgccgctgcggtgggc
tggcagctgggcgtggcaccggacgcgatcgcgcgcgcactggaaggcttcgccggtgtc
ggccgtcgcttcaacgatctgggcgaagtgaccaccgccagcggcgccaaggtccgcatc
atcgacgactacggtcatcacccgagcgagctggaagcggtgttcgccgccgcccgtggt
ggctgggccgacaagcgcctggtggtggccttccagccgcaccgctacagccgtacccgc
gaccagttcgacaagttcgccgcagtgctgtccagcgtcgatgcactggtgctgagcgag
gtctacccggccggcgaggaaccgattgctggtgccgattcgcatgcgttggcccgcgcc
atccgtgcgcgtggccgcagcgagccggtggtggtgggcaaggccgccgagctggccagc
gtgctgccggacgtgctgcaggacggtgacctgctgctgatgatgggtgccggcgacatc
ggtgccgtggccacccatatcgcggtggaaggcttcaagggggagggcgaggcgtga

DBGET integrated database retrieval system