KEGG   Stenotrophomonas sp. ASS1: MG068_04030Help
Entry
MG068_04030       CDS       T06051                                 

Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
stes  Stenotrophomonas sp. ASS1
Pathway
stes00260  Glycine, serine and threonine metabolism
stes01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stes00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MG068_04030
Enzymes [BR:stes01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     MG068_04030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 FAD_binding_3 FAD_binding_2 Pyr_redox_2 Pyr_redox_3 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: QBL42899
UniProt: A0A4V1A8G2
LinkDB All DBs
Position
complement(868390..869412)
Genome map
AA seq 340 aa AA seqDB search
MKALVKREAAKGIWLEEVPVPTPGPNEVLIKLEKTAICGTDLHIYLWDEWSQRTIKPGLT
IGHEFVGRVAALGSAVTGYEIGQRVSAEGHIVCGHCRNCRGGRPHLCPNTVGIGVNVNGA
FAEYMVMPASNLWPIPDQIPSELAAFFDPYGNAAHCALEFNVIGEDVLITGAGPIGIIAA
GICKHIGARNVVVTDVNDFRLKLAADMGATRVVNVANQSLKDVMKELHMEGFDVGLEMSG
NPRAFNDMLDCMYHGGKIAMLGIMPKGAGCDWDKIIFKGLTVQGIYGRKMYETWYKMTQL
VLSGFPLGKVMTHQLPIDDFQKGFDLMEEGKAGKVVLSWN
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccctggtcaagcgcgaagcggccaagggcatctggctggaagaagttccggtt
ccgaccccgggcccgaacgaggtcctgatcaagctcgagaagaccgcgatctgcggcacc
gacctgcacatctacctgtgggacgagtggagccagcgcaccatcaagccgggcctgacc
atcggccacgaattcgtcggtcgcgtcgccgcactcggctcggccgtgaccggctatgaa
atcggccagcgcgtctcggccgaaggccacatcgtctgcggccactgccgcaactgccgt
ggcggccgcccgcacctgtgcccgaacaccgtcggcatcggcgtcaacgtcaacggcgcc
ttcgccgagtacatggtgatgccggccagcaacctgtggccgatcccggaccagattccg
tccgagctggccgcgttcttcgatccgtacggcaacgccgcgcattgcgcgctggagttc
aacgtgatcggtgaagacgttctgatcaccggtgccggcccgatcggcatcatcgccgcc
ggcatctgcaagcacatcggtgcgcgcaacgtggtggtgaccgacgtcaacgacttccgc
ctgaagctggccgccgacatgggtgccacccgcgtggtcaacgtggccaaccagtcgctg
aaggacgtgatgaaggaactgcacatggagggcttcgacgtgggcctggaaatgagcggc
aacccgcgcgcgttcaacgacatgctcgattgcatgtaccacggcggcaagatcgccatg
ctcggcatcatgcccaagggcgccggctgcgactgggacaagatcatcttcaagggcctg
accgtgcagggcatctacggccgcaagatgtacgagacctggtacaagatgacccagctg
gtgctgtccggcttcccgctcggcaaggtgatgacccaccagctgccgatcgacgacttc
cagaagggcttcgacctgatggaagaaggcaaggccggcaaggttgtgttgagctggaat
tga

DBGET integrated database retrieval system