KEGG   Streptococcus salivarius 57.I: Ssal_00289Help
Entry
Ssal_00289        CDS       T02088                                 

Gene name
scrK
Definition
(GenBank) fructokinase
  KO
K00847  fructokinase [EC:2.7.1.4]
Organism
stf  Streptococcus salivarius 57.I
Pathway
stf00051  Fructose and mannose metabolism
stf00500  Starch and sucrose metabolism
stf00520  Amino sugar and nucleotide sugar metabolism
stf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Ssal_00289 (scrK)
   00500 Starch and sucrose metabolism
    Ssal_00289 (scrK)
   00520 Amino sugar and nucleotide sugar metabolism
    Ssal_00289 (scrK)
Enzymes [BR:stf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.4  fructokinase
     Ssal_00289 (scrK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AEJ52693
UniProt: F8HFF3
LinkDB All DBs
Position
263238..264131
Genome map
AA seq 297 aa AA seqDB search
MAKLYGSLEAGGTKFVCAVGDEKFQVVEKTQFPTTTPYETIDRTIEFFKRYEDQLAGIAI
GSFGPIDVDPNSETYGFVTSTPKPHWSNVDLLGLIAKEFIVPFYFTTDVNSSAYGETLVR
KGVKSLVYYTIGTGIGAGAIQNGEFIGGMGHTEAGHVYVPLHPNDVSNEFNGTCPFHRGC
LEGLAAGPSLEARTGIRGELIDQHSEVWDVQAYYIAQAAVQATVLYRPEVIVFGGGVMGQ
EHMLRRVREKFTALLNGYLPVPDVNEYIVTPAVSGNGSATLGNFALAKDVADKHANK
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggctaaactatacggaagcttggaagctggtggtacaaaatttgtttgtgctgtcggt
gatgagaaattccaagtcgttgaaaaaactcaattcccaacaactacaccttatgaaaca
attgatcgtacgattgaatttttcaaacgttatgaggaccaattggctggaatcgctatt
ggttcattcggtccaattgatgttgatccaaactctgaaacatatggttttgtgacttca
acaccaaaaccacattggtcaaatgttgaccttcttggtttgattgctaaagagtttatt
gtgcctttctactttacgactgatgttaactcatctgcttatggtgagacacttgttcgt
aaaggtgttaagagtcttgtttactacactatcggaacaggtatcggagctggagctatt
caaaatggtgaattcattggtggtatgggtcatactgaagctggtcacgtatatgtaccg
cttcacccaaatgatgtttccaatgaatttaacggaacttgtccattccaccgtggatgt
ttggaaggtttggctgctggaccatcgcttgaagcccgtacaggtattcgtggtgaattg
attgatcagcactctgaagtttgggatgttcaagcttactacattgctcaagcggctgtc
caagcaacagtcctttaccgtcctgaagttatcgtctttggtggcggtgttatggggcaa
gaacacatgcttcgtcgtgttcgtgaaaaattcacagctcttttgaatggttaccttcca
gtaccagatgtaaatgaatatattgtgacacctgctgtttcaggtaatggctctgcaaca
cttggtaacttcgcacttgctaaagatgtagctgacaagcatgcaaacaaataa

DBGET integrated database retrieval system