KEGG   Streptococcus salivarius 57.I: Ssal_00472Help
Entry
Ssal_00472        CDS       T02088                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
stf  Streptococcus salivarius 57.I
Pathway
stf00473  D-Alanine metabolism
stf00550  Peptidoglycan biosynthesis
stf01100  Metabolic pathways
stf01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:stf00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Ssal_00472 (ddl)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Ssal_00472 (ddl)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Ssal_00472 (ddl)
Enzymes [BR:stf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Ssal_00472 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:stf01011]
 Precursor biosynthesis
  Amino acid ligase
   Ssal_00472 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST GARS_A MsyB
Motif
Other DBs
NCBI-ProteinID: AEJ52853
UniProt: F8HGB4
LinkDB All DBs
Position
422619..423665
Genome map
AA seq 348 aa AA seqDB search
MSKQTLILLYGGRSAEREVSVLSAESVMRAVDYSAFEVKTYFITQSGDFIKTQEFTETPG
DDEKLMTNATVVASQAIKPSDIYEEGAVVFPVLHGPMGEDGSIQGFLETLKLPYVGTNVL
SSSVAMDKIMTKHILEVAGVPQVAYTVFIEGEDLEVAVAETLEKLTFPVFVKPANMGSSV
GISKAENEAELRAAIDLALKYDSRILIEQGVVAREIEVGILGNTNVKTTDPGEVVKDVAF
YDYQAKYIDNKITMDIPAHVPAEVMTQMRAYAAKAFRALGGCGLARCDFFLTEDGAIYLN
ELNTMPGFTQWSMYPLLWENMGLSYSDLIKELVALGQEMFDKRESHLI
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaacaaacccttatccttctctacggtggacgttcagcagaacgtgaagtgtct
gtgctctcagctgagagtgttatgcgtgcggtggattacagcgcatttgaggttaaaacc
tactttatcactcagtctggtgattttatcaaaacacaagaatttacagaaacaccaggt
gatgatgagaagctcatgaccaatgctacagttgtggctagtcaggctatcaaaccaagc
gatatttatgaagaaggcgctgtggtattcccggttcttcatggtcctatgggtgaggat
ggttctatccaaggtttcctcgaaaccctcaaattgccatatgtgggtactaatgttctt
tcttcaagtgtggctatggacaagattatgaccaagcatattcttgaagttgctggtgtg
cctcaggttgcctatacagtcttcatcgagggtgaagatttggaagtagcagtagctgaa
acgcttgaaaaattgaccttcccagtgtttgtcaaacctgctaacatggggtcatctgtt
gggatttctaaagctgaaaatgaagcagagcttcgtgcagcgattgatttggctctcaaa
tatgatagtcgtatcttgattgagcaaggtgtggttgcccgagaaatcgaggttggtatc
cttggcaatacaaatgtcaaaacgactgatccaggtgaagtagtcaaggatgtggctttc
tatgactaccaagccaagtatattgacaacaagattaccatggacatcccagctcacgtg
cctgcagaagtcatgacacaaatgcgtgcctatgcggccaaggccttccgtgccctaggt
ggttgtggtcttgcccgttgtgatttcttcctgacagaggatggagccatctatcttaac
gagctcaacaccatgccaggtttcacccaatggtcaatgtacccacttctttgggaaaat
atgggactttcttactcagaccttatcaaggaattggtggccttgggacaagaaatgttt
gacaaacgtgaaagccatttgatttaa

DBGET integrated database retrieval system