KEGG   Streptococcus salivarius 57.I: Ssal_00523Help
Entry
Ssal_00523        CDS       T02088                                 

Gene name
amyA
Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
stf  Streptococcus salivarius 57.I
Pathway
stf00500  Starch and sucrose metabolism
stf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Ssal_00523 (amyA)
Enzymes [BR:stf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Ssal_00523 (amyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF1939 Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: AEJ52901
UniProt: F8HB52
LinkDB All DBs
Position
complement(472627..474060)
Genome map
AA seq 477 aa AA seqDB search
MQYFEWYLPSDGQHWNNLADDAQHLADLGISHVWMPPAFKATNKDDVGYGVYDLFDLGEF
DQKGTVRTKYGLKEEYLNAINQLKEVGIVPMADVVLNHKAAADKLETFEVVEVDPEDRTQ
EISEPFEIEGWTHFTFDGRNKAYNDFEWHWYHFNGTDFDAKRNKSGIYLIQGDNKGWADN
DLVDNENGNFDYLMYANLDYKHPEVIENIYEWADWFVETTGVQGFRMDAVKHIDSFFMRN
FIRDVKEKQGQDFYVFGEFWNGNEEENNIYLEKIEKRFDLVDVPLHNNLHKASLDGADYD
LTTIFDHSLVKNHPEHAVTFVDNHDTQRGQALESTVEEWFKPAAYALILLREDGLPCLFY
GDYYGIEGEFAQENFQETLDTLLYARKDLAYGEQTDYFDDPNCIGWTRSGNEDGAPLAVT
ISNDAANSKSMEIGSDWAGQTFYDILGNCSDTVTIDEDGWGDFPVSEKSVSVWTIQD
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgcaatactttgaatggtatcttccaagtgacggtcaacactggaacaatttggctgat
gatgcccaacatttagcagacctgggcatcagccacgtttggatgccacctgcttttaag
gccaccaacaaagatgatgttggttacggagtctatgacctctttgaccttggagaattc
gaccaaaaaggaacagtccgcaccaaatacggcctcaaagaagagtatctcaatgctatc
aaccaactcaaagaagttggtattgtacctatggccgacgttgtgcttaaccacaaggca
gcagccgataaactcgagaccttcgaagtggtcgaagttgacccagaggaccgtacccaa
gaaatcagcgaaccatttgaaatcgaaggttggacacacttcacctttgacggacgtaat
aaagcctacaacgattttgaatggcactggtaccactttaacggaactgacttcgatgcc
aaacgtaataaaagtggcatctatcttatccaaggtgacaacaaaggttgggcagacaac
gacttggttgacaatgagaatggtaactttgactaccttatgtatgctaacctagactat
aaacaccctgaagttattgaaaacatttacgaatgggcagattggttcgttgaaacaaca
ggcgttcaaggattccgcatggatgcagtcaagcacattgattcattcttcatgcgtaac
tttattcgtgatgtcaaagaaaaacaaggtcaggatttctatgtctttggtgaattttgg
aatggtaacgaagaggaaaataatatctatcttgaaaagattgaaaaacgttttgacctc
gtcgatgttcccctccacaacaatctacacaaggctagcttagatggtgccgattatgat
ttgacgacaattttcgatcattccttggtcaaaaatcatcctgaacatgctgtaaccttc
gtagacaaccacgacactcaacgcggacaagctctagaatctactgttgaagaatggttt
aaaccagctgcttatgctctcatccttctccgtgaagacggtcttccttgcctattttat
ggtgactactatggaatcgaaggtgaatttgctcaagaaaatttccaagaaaccctagat
accttgctctacgctcgtaaagacctagcttacggagagcaaacagactactttgatgat
ccaaactgtattggatggacacgctctggcaacgaagatggcgctccattagctgtaaca
atctctaatgatgctgctaacagcaagtctatggaaattggtagtgattgggctggacaa
accttctatgacattcttggaaactgctctgatactgtaaccattgacgaagacggatgg
ggagacttcccagtttctgaaaaatctgtcagcgtttggacaattcaagactaa

DBGET integrated database retrieval system