KEGG   Streptococcus salivarius 57.I: Ssal_01136Help
Entry
Ssal_01136        CDS       T02088                                 

Gene name
aceF
Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
stf  Streptococcus salivarius 57.I
Pathway
stf00010  Glycolysis / Gluconeogenesis
stf00020  Citrate cycle (TCA cycle)
stf00620  Pyruvate metabolism
stf01100  Metabolic pathways
stf01110  Biosynthesis of secondary metabolites
stf01120  Microbial metabolism in diverse environments
stf01130  Biosynthesis of antibiotics
stf01200  Carbon metabolism
Module
stf_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:stf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ssal_01136 (aceF)
   00020 Citrate cycle (TCA cycle)
    Ssal_01136 (aceF)
   00620 Pyruvate metabolism
    Ssal_01136 (aceF)
Enzymes [BR:stf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Ssal_01136 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 HlyD_3
Motif
Other DBs
NCBI-ProteinID: AEJ53434
UniProt: F8HD82
LinkDB All DBs
Position
complement(1124416..1125798)
Genome map
AA seq 460 aa AA seqDB search
MAFEIIMPKLGVDMQEGEIIEWKKQEGDVVNEGDILLEIMSDKTNMELEAEDSGVLLKIT
RQAGETVPVTEVIGYIGAEGEVVADNVASAPAAEPTTKVEEVATVEAPVVATQAPVVHEG
GKVRATPKARKVARELGIDLTQVPGTGAKGRVHADDVENFKGAQPKATPLARKIAADLGI
DLASVSGTGFGGKITKEDILAISAPAQVKEAAAAPVVEAKPEKVLPEGVEVIPMSAMRKA
ISKGMTHSYLTAPTFTLNYDVDMTNLMALRKQILDPIMNKTGMKVTFTDLIGLAVVRTLM
KEEHRYINASLIDDAQNIELHKFVNLGIAVGLDDGLIVPVVHGADKMSLSEFVVASKDVI
KKAQAGKLKAAEMSGSTFSITNLGMFGTKSFNPIINQPNSAILGVSATIQTPVVVDGEVV
VRPIMGLCLTIDHRIVDGMNGAKFMVDLKHLIENPMELLI
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgagattattatgcctaagcttggtgttgatatgcaggaaggcgaaatcatc
gagtggaagaaacaagagggtgatgtggtcaatgagggagatattctccttgaaatcatg
tcagataagacgaacatggaacttgaagcagaagattctggtgttcttttgaagattact
cgtcaggctggtgaaacagtaccagttactgaggttattggttatattggagcagaaggt
gaagtggtggctgataacgtagctagcgcaccagctgctgaacctacgacaaaagttgaa
gaagtagctactgtagaagcacctgtagtggcaacccaggctcctgtcgtacacgaaggt
ggcaaagtacgtgcaacacctaaggctcgtaaggtggcgcgtgagttgggcattgacctc
actcaagttccaggaactggagcaaaaggtcgtgttcatgctgatgacgttgaaaacttt
aagggtgctcaacctaaggcgactccattggcacgtaagattgcagcggaccttggtatt
gacttagctagcgtatctggaacaggctttggtggcaagattactaaggaagatatcctt
gcaatcagtgccccagcgcaagttaaggaagcggctgctgcacctgtggttgaagctaaa
cctgaaaaagttttgccagaaggcgtggaagtcatcccaatgtctgctatgcgtaaggca
atttctaagggaatgacgcactcatacttgactgcaccaacctttactcttaactatgac
gtggacatgactaaccttatggctcttcgtaagcaaatcctagacccaatcatgaataag
actggtatgaaggtaaccttcacggatttgattggtttggcagttgtgcgtacccttatg
aaagaggaacaccgttacatcaatgcatccttgattgacgatgcgcaaaatatcgaatta
cacaaatttgttaatctcggtattgccgttggtctcgatgatggcttgattgtacctgtc
gttcacggtgcagataagatgagtttgtctgagtttgttgtggcttctaaggatgtcatc
aagaaggctcaggctggtaaattgaaggctgctgaaatgtcaggttcaaccttctctatt
actaacttgggaatgtttggaaccaaatcatttaacccaatcatcaaccaaccaaactca
gctatccttggtgtttcagcaacgattcaaactccagttgttgttgatggggaagttgtc
gtacgtccaatcatgggtctatgcttgacaattgaccaccgtattgtagatggtatgaat
ggtgccaaattcatggttgatttgaaacatttgattgaaaatcctatggaattgttgatt
taa

DBGET integrated database retrieval system