KEGG   Streptococcus salivarius 57.I: Ssal_01499Help
Entry
Ssal_01499        CDS       T02088                                 

Gene name
tktA
Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
stf  Streptococcus salivarius 57.I
Pathway
stf00030  Pentose phosphate pathway
stf01100  Metabolic pathways
stf01110  Biosynthesis of secondary metabolites
stf01120  Microbial metabolism in diverse environments
stf01130  Biosynthesis of antibiotics
stf01200  Carbon metabolism
stf01230  Biosynthesis of amino acids
Module
stf_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:stf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Ssal_01499 (tktA)
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    Ssal_01499 (tktA)
Enzymes [BR:stf01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     Ssal_01499 (tktA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C E1_dh DXP_synthase_N TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: AEJ53771
UniProt: F8HED8
LinkDB All DBs
Position
complement(1475905..1477791)
Genome map
AA seq 628 aa AA seqDB search
MGAAPMAYVLWNHVMNVNPKTSRNWTNRDRFVLSAGHGSALLYSLLHLSGYDVTMDDLKN
FRQWGSKTPGHPEVNHTDGIEATSGPLGQGIANAVGMAMAEAHLAAKFNKPGFDIVDHYT
YALHGDGCLMEGVSQEAASLAGHLKLGKLVLLYDSNDISLDGPTSMAFTEDVKAKFEAYG
WQHILVKDGNDLEAIAKAIEEAKAETDKPSIIEVKTIIGYGAEGQGTSAVHGAPIGQDGI
DHAKGVYGYDAPAFTVPDEVARRFEVGIKFRGEAAENAWQTKFAEYEAAYPELAAEYKAA
FANEPVHVDLNAHELGSAVASRVSSQQAIQQISEQVPSFWGGSADLSASNNTMVKAESDF
QPDNYAGRNIWFGVREFAMAAAMNGIALHGGTRVYGGTFFVFSNYLLPAVRMAALQNLPV
TYVMTHDSVAVGEDGPTHEPIEQLASVRSMPNLNVIRPADGNETNAAWKRALAETERPTM
LVLTRQNLPVLDGTAENAEAGVNKGAYIISEAKGDLDGIIIATGSEVKLALDTQAALEAE
GVHVRVVSMPSQNLFDEQDAAYKEEVLPAAVTKRLAIEAGTSFGWGKYVGLAGKTLTIDT
WGASAPGDRIFKEYGFTVENASQLYKSL
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcagcgccgatggcttatgtgctttggaaccatgtgatgaatgttaatccaaag
acaagccgtaactggacaaaccgtgaccgttttgttctttctgcaggtcatggttctgcc
ttactttatagtctcttgcacctttctggctacgacgtgacaatggacgacttgaagaac
ttccgtcaatggggatctaagactccaggtcaccctgaagttaaccatacagatggtatt
gaagcaacatcaggtcctcttggtcaaggaattgctaatgctgtaggtatggcaatggct
gaagcacacttggcagctaaatttaacaaacctggttttgatattgttgaccattatact
tatgccctccatggcgatggatgtttgatggaaggtgtttctcaagaagctgctagtctt
gctggtcaccttaaacttggtaagttggtacttctttacgattcaaatgatatctcactt
gatgggccaacttcaatggctttcactgaagatgttaaggctaagtttgaagcttatggt
tggcaacacattcttgtcaaagatggtaatgatttggaagctattgctaaagcaatcgaa
gaagctaaagctgagacagataaaccatctattatcgaagttaagacaatcattggttac
ggagctgaaggacaaggaacatcagctgtccacggtgctccaattggtcaagacggcatt
gatcatgcaaaaggtgtttatggttacgatgcaccagcatttacagttccagatgaagtc
gctcgtcgtttcgaagttggtattaaattccgtggtgaagctgctgaaaatgcttggcaa
actaaatttgcagaatatgaagctgcttacccagaattggctgcggaatacaaggctgcc
tttgcgaatgaacctgtacacgttgacttgaatgctcatgaattgggttcagcagtagct
agccgtgtgtcaagccaacaagctatccaacagatttctgaacaagttccttcattctgg
ggaggttcagcagacctttcagcttctaacaatactatggttaaggctgagtctgatttc
caaccagacaactatgctggacgtaatatttggttcggtgtacgtgagtttgctatggct
gcagcgatgaatggtattgctcttcatggtggtactcgcgtttatggtggtactttcttc
gtcttctcaaactacttgcttccagcagtacgtatggcagcacttcaaaacttgccagta
acttatgttatgacgcacgactcagtagcagttggtgaagatggacctactcacgaacca
atcgaacaattggcaagtgtgcgttcaatgcctaaccttaacgttatccgtcctgcagat
ggtaatgaaactaatgctgcatggaaacgtgccttggctgagactgaacgtccaacaatg
ttagttttgacacgtcaaaacttgccagtccttgatggtacagctgaaaatgctgaagct
ggtgtcaataaaggggcttacatcatctcagaagctaaaggtgatcttgatggtatcatc
attgcgactggttctgaagtgaaattggctcttgatacgcaagctgctcttgaagcagaa
ggtgtgcatgttcgtgttgtttcaatgccatcacaaaatctctttgatgaacaagatgct
gcttacaaagaagaagttcttccagcagctgtgacaaaacgtttggctattgaagccgga
acaagctttggttggggcaaatacgttggtcttgcaggtaaaacacttactatcgatact
tggggggcatcagcacctggtgaccgtatctttaaagaatatggtttcactgttgaaaat
gcaagtcaactttacaaatcattgtag

DBGET integrated database retrieval system