KEGG   Streptococcus salivarius 57.I: Ssal_02102Help
Entry
Ssal_02102        CDS       T02088                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
stf  Streptococcus salivarius 57.I
Brite
KEGG Orthology (KO) [BR:stf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Ssal_02102 (ahpF)
Enzymes [BR:stf01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Ssal_02102 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 GIDA FAD_oxidored Thioredoxin_3 HI0933_like Thi4 DAO AlaDh_PNT_C FAD_binding_3 NAD_binding_7 NAD_binding_8 Lycopene_cycl Glutaredoxin K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AEJ54313
UniProt: F8HBZ6
LinkDB All DBs
Position
2062236..2063768
Genome map
AA seq 510 aa AA seqDB search
MVLDKEIKTQLAQYLNLLESDIVLQTDLGDDDNSRKVKEFLDEIAAMSDRISLESTHLKR
QPSFGIAQKGQKSRVIFSGLPMGHEFTSFILALLQVSGRPPKVDEDTIERIKKIDKPIDL
ETYVSLTCHNCPDVVQAFNIMAVLTPNITHTMIEGGMYQDEVKTKGIMSVPTVYKDQEEF
TSGRATIEQLVEKLDGPLDADAFADKGVYDVLVIGGGPAGNSAAIYAARKGLKTGLLAET
FGGQVIETVGIENMIGTLYTEGPKLMAQVEEHTKSYDVDIIKSQLATGIEKKELIEVTLA
NGAVLKSKTAILALGAKWRNINVPGEEEFRNKGVTYCPHCDGPLFEGKNVAVIGGGNSGL
EAALDLAGITKHVTVLEFLPELKADQVLQERAAKTDNLTILKNVATKEIVGQDHVTGLNY
VERDTNEEKHLDLEGVFVQIGLVPSTAWLKDSGIELNERQEIIVDKFGSTNIPGIFAAGD
CTDSAYKQIIISMGSGATAAIGAFDYLIRQ
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggtcttagataaagaaatcaagacacaattagcacaatatttaaatttactagaatct
gatattgtattacaaacagacttaggggatgacgataattctcgaaaagtaaaagaattt
cttgacgagattgccgctatgtctgaccgcattagtcttgaatcaacacatttaaaacgt
caacctagttttggtattgcacaaaaagggcaaaaaagtcgtgttattttctcaggctta
ccaatgggccacgaattcacatctttcattttagctctcttgcaagtttctggtcgtcca
ccaaaagttgatgaggacactatcgaacgtatcaagaagattgataaacccatcgattta
gaaacctatgtttcattaacatgtcacaattgtccagacgttgttcaagcttttaatata
atggctgttttgaccccaaatatcactcacaccatgattgaaggtggtatgtatcaggat
gaggtcaaaaccaaaggtatcatgtctgttcctacggtttacaaagaccaagaagaattt
acatctggtcgtgcaaccattgaacagcttgttgaaaaattggacggaccacttgatgct
gatgctttcgctgataaaggtgtctatgatgttttggttattggtggtggtcctgctgga
aacagtgcggccatctatgctgcccgtaaaggtttaaaaactggtcttttagcagaaacc
tttggtggacaagttatcgagacagtcggcattgagaacatgattggtacgctatataca
gaaggtcctaagttaatggcccaagttgaagagcatacgaaatcttatgatgttgatatc
atcaaaagtcaattagctactggcattgagaaaaaagaactcattgaagtgacactggct
aacggtgccgttttaaaatccaaaactgctatcctagctctcggagccaaatggcgtaat
atcaacgttcctggcgaggaagaattccgcaataaaggggttacttactgcccacactgt
gatggtccactatttgaaggaaagaatgttgcagttatcggtggtggtaactcaggtttg
gaagcggctttagatttagcaggcattactaaacatgttacggtcttagagttcttacct
gaattaaaggcagatcaagtcttacaagaacgagctgctaaaactgataatctcacaatt
cttaagaacgttgcaaccaaagaaattgttggtcaagatcatgtaactggtttgaattac
gttgagcgtgatacaaacgaagaaaaacatcttgatcttgaaggtgtctttgttcaaatt
ggtcttgtaccaagtactgcttggctcaaagatagtggcattgaactcaatgagcgccaa
gaaattatcgttgataaatttggttcaacaaatatccctggtatttttgctgcaggtgac
tgtacagatagcgcctacaagcaaatcattatctccatggggtctggtgctacagctgct
attggagcctttgattacttgattagacaataa

DBGET integrated database retrieval system