KEGG   Streptococcus pyogenes MGAS15252 (serotype M59): MGAS15252_1097Help
Entry
MGAS15252_1097    CDS       T01794                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase protein Ddl
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
stg  Streptococcus pyogenes MGAS15252 (serotype M59)
Pathway
stg00473  D-Alanine metabolism
stg00550  Peptidoglycan biosynthesis
stg01100  Metabolic pathways
stg01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:stg00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    MGAS15252_1097 (ddl)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MGAS15252_1097 (ddl)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    MGAS15252_1097 (ddl)
Enzymes [BR:stg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     MGAS15252_1097 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:stg01011]
 Precursor biosynthesis
  Amino acid ligase
   MGAS15252_1097 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AFC66434
LinkDB All DBs
Position
complement(1092385..1093431)
Genome map
AA seq 348 aa AA seqDB search
MSKQTLVLLYGGRSAEREVSVLSAESVMRAVNYDKFLVKTYFITQMGQFIKTQQFSEKPS
ESERLMTNETIELTQKIKPSDIYEEGAVVFPVLHGPMGEDGSIQGFLEVLRMPYIGTNVM
SSSIAMDKITTKRVLESIGIPQVAYTVYIDGQDLEACLVETLARLTFPIFVKPANMGSSV
GISKAQTKVELRKAIQLALTYDSRVLIEQGVVAREIEVGLLGNDKVKSTLPGEVIKDVDF
YDYQAKYVDNKITMAIPADVDQSIVTEMRSYAEVAFKALGGCGLSRCDFFLTQDGQVYLN
ELNTMPGFTQWSMYPLLWENMGLAYPDLIEELVTLAQEMFDQRESHLI
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaacaaacgttagttctattatacggaggccgctcagcagaacgtgaagtctca
gtgctttcagcagagagtgtgatgcgagcagtcaactatgataagttcttagtaaaaact
tattttattactcagatgggccaatttatcaaaactcagcaattttcagaaaagccatcg
gaatcagaacgcttaatgacaaatgagacgatagagctaactcaaaaaataaaaccaagt
gatatctatgaagaaggtgcagttgtatttcctgtattacatggacctatgggagaagat
ggctctatccaaggtttcttagaagtgcttagaatgccatatatagggactaatgtcatg
tcttctagcatagctatggataaaattactactaaacgtgtcttagaatcaattggaatt
ccacaagttgcctatactgtttatattgacggacaagatttggaggcttgtttagttgaa
actttagcaagacttacttttcctatcttcgtaaaaccagctaatatgggttcttctgtg
gggatttccaaagcccaaacaaaagtagaattaagaaaagcgattcagttagccctgacc
tatgacagtcgtgtcttgattgaacaaggcgtggttgccagagaaattgaagttggtctc
cttggaaatgataaggttaaatcaactctaccaggagaagtaatcaaggacgttgatttt
tacgactaccaagcaaaatatgttgacaataagattacgatggccattccagcagatgta
gaccagagtattgtgacagaaatgcgttcttatgctgaagtagcctttaaagccttaggt
ggttgtgggttgtcccgttgtgactttttcttgacccaagacggacaggtttaccttaac
gaattaaacaccatgccaggctttacccaatggtctatgtatccactcttatgggaaaat
atgggattggcttatccagatttgattgaagagctggtgacactggcacaagaaatgttt
gaccagcgtgagagccacctgatttaa

DBGET integrated database retrieval system