KEGG   Symbiobacterium thermophilum: STH1873Help
Entry
STH1873           CDS       T00196                                 

Definition
(GenBank) threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
sth  Symbiobacterium thermophilum
Pathway
sth00260  Glycine, serine and threonine metabolism
sth01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sth00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    STH1873
Enzymes [BR:sth01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     STH1873
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C AlaDh_PNT_C TNFR_c6
Motif
Other DBs
NCBI-ProteinID: BAD40858
UniProt: Q67N85
LinkDB All DBs
Position
complement(2013575..2014630)
Genome map
AA seq 351 aa AA seqDB search
MAETMRALRKLEAGPGATLQEVPIPTIGPRDVLVKVRAASICGTDYHIYTWDPWSAGRVK
PPLTIGHELAGEVVAVGREVTACKVGDYVSAETHIVCNRCPRCHMGEYHLCENTKILGVD
TDGAFAEYVAVPEQNIWVNDKDIPFELQSIQEPLGNAVHTALNGDLTARSVLITGCGPIG
IMSVPVAKMAGAEIVMAMDINEYRLQLAGQLGADVLINPTKQDPVEVVRSYTRGYGADVV
LEMSGNPTAIRQGLKAARNGARISLLGLPGRPLELDLAADVIMRGLVLQGITGRRMWQTW
YQVRSLYRAGLAERLRPLVTHRMPLEQIDAAMELMGSGQSGKIVLVPDLKA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
gtggcagaaacgatgcgtgctttgcgaaaactggaagctggtcctggcgcgacactgcag
gaggttccgatcccgaccatcggcccccgcgacgtcctggtgaaggtccgggcggcctcg
atctgcggcacggactaccacatctacacctgggatccgtggtccgcgggccgggtgaag
ccgccgctcaccattgggcacgagctggccggtgaggtggtggccgtcggccgcgaggtc
accgcatgcaaggtgggcgactacgtctctgccgaaacgcacattgtttgcaaccgctgt
ccccgctgccacatgggggagtaccacctctgcgagaacacgaagatcctgggggtggac
acggacggcgccttcgccgagtacgtcgcggtgccggagcagaacatctgggtgaacgac
aaggacatcccctttgagctgcagtcgattcaggagccgctgggcaacgcggtccacacg
gccctgaacggcgacctcaccgcccggtccgtgctgatcaccggctgcggccccatcggc
atcatgtcggtccccgtggccaagatggccggcgcggagatcgtgatggcgatggacatc
aacgaataccggctgcagctggcgggccagctgggggccgacgtgctcatcaaccccacg
aagcaggatccggtcgaggtggtgcgcagctacacccgcggctacggcgccgacgtggtg
ctggagatgtcgggtaaccccaccgccatccggcaggggctgaaggccgcccgcaacggc
gcccgcatctcgctcctcggtctgcccggccggccgctggagctggacctggcagcggac
gtgatcatgcggggcctggtgctgcagggcatcaccggccgccggatgtggcagacctgg
tatcaggtgcgttccctctaccgggccgggctggcggagcggctgcggccgctggtgacg
caccggatgccgctggagcagatcgacgccgccatggagctcatgggttccggccagagc
ggcaagatagtgctggtgcctgacctgaaggcgtga

DBGET integrated database retrieval system